Home
Description
Design
Engineering
Results
Contributions
Parts
Protocol
Implementation
Modelling
Notebook
Safety
Human Practices
IHP
Education
Excellence
Attributions
Collaborations
Team
Partnership
Judging Form
Modelling
Introduction
We have used mathematical, structural and simulation modelling to explain the various functional aspects of the project. We have developed five models for processes like protein-cell internalisation, TRAIL-induced apoptosis machinery (the caspase cascade) and our novel holin-antiholin killswitch with time-delay.- Smac Internalisation Kinetics
- MD simulations for Smac Internalisation
- Caspase Cascade Kinetics
- Kill Switch with Time delay
- Structural Modelling
R8-Smac(n7) Internalisation Kinetics
Description
After the fusion peptide cleaves by metalloprotease, the part containing R8-Smac(n7) internalises the cancer cell to inhibit XIAP. The rate of internalisation of this protein plays an essential role in the apoptosis of the cancer cell. The rate of uptake determines how effectively the fusion peptide population can inhibit the XIAPs. In other words, if the protein internalises quickly and enters the cell in large quantities, the protein can bind with more XIAPs and stop them from inhibiting the caspase-cascade reaction.Methods and Pathways
We have made a deterministic model using Michaelis Menten kinetics. We have assumed the protein R8-Smac(n7) present outside the cell forms an enzyme-substrate complex with the cell membrane. The complex then dissociates to give internalised R8-Smac(n7).The pathway for this process can written as
R8-Smac(n7)outside + CM ⇋ R8-Smac(n7)-CM → R8-Smac(n7)inside + CM
Here the reactants are,
Parameters for reactions
The reaction rate constants were estimated using experimental data from various papers discussing polyarginine to transport cargo via membrane translocation and experimented on HeLa cells.Results and Conclusions
The model shows that the rate of internalisation is high initially and decreases as the reaction proceeds. Experimental data from various sources showed that the time taken for 90% internalisation cargo proteins attached with polyarginine was around 120+ minutes and the cargo protein size (150-250 amino acids) used is much bigger than R8-Smac(n7) (only 16 amino acids). Since our fusion protein is small, we assumed that our protein will have a higher rate of internalisation. However, moderately big proteins tend to have a better rate of internalisation since they can make a bigger pore in the cell membrane. Considering these factors, we predicted that 90% of the protein will get internalised after 1.5 - 2 hours.
References
- Simon W. Jones, Richard Christison, Ken Bundell, Catherine J. Voyce, Sarah M.V. Brockbank, Peter Newham, Mark A. Lindsay, Characterisation of cell-penetrating peptide-mediated peptide delivery.
- Ülo Langel, Cell-Penetrating Peptides and Transportan.
- Esther Vázquez, Rafael Cubarsi, Ugutz Unzueta, Mónica Roldán, Joan Domingo-Espín, Neus Ferrer-Miralles, Antonio Villaverde. Internalization and kinetics of nuclear migration of protein-only, arginine-rich nanoparticles.
- Ülo Langel, Cell-Penetrating Peptides, Chapter 8: Kinetics of CPPs Cellular Uptake.
- https://2013.igem.org/Team:TecMonterrey/Project.html
R8-Smac(n7) Internalisation: MD Simulations
Description
After the fusion protein gets cleaved by metalloproteases into R8-Smac(n7) and fusion TRAIL, the R8-Smac(n7) fusion peptide must internalise inside the cancer cell’s cytoplasm. The fusion peptide contains a CPP (cell-penetrating peptide), polyarginine having eight residues in our case, to assist Smac(n7)’s entry into the cell. Due to delayed wet lab access, we did molecular dynamics simulations to study the interaction of R8-Smac(n7) and Smac(n7) and the plasma membrane of a cancer cell.Methods and Procedures
We first studied the composition of the lipid bilayer. We found that the cancer cells which are near the metastasis stage have asymmetric bilayer composition. Since our project is for the early stages of cancer, we went with an asymmetric lipid bilayer. We used the lipid composition given below.We first tried to predict the structure of R8-Smac(n7) and Smac(n7) using a python library modeller. We ran a 1μs MD simulation to see how the protein folds in the presence of water molecules and ions and found that the protein takes the shape of a simple coil.
Our next step was to set up a lipid bilayer and protein system for the simulation. We used Martini Bilayer Maker to set up a coarse-grain simulation since we couldn’t afford all-atom simulations due to the delayed access to resources. We used GROMACS and CHARMM force fields for energy minimization, equilibration and production run. Prior to full simulation, we are using steered MD simulations (SMD) to obtain windows in the reaction coordinates that can be used for umbrella sampling. This step is still in progress. Initially, we set up the system using 120 lipids on each bilayer leaflet consisting of the lipids mentioned above in appropriate ratios. We introduced polar water molecules and ions on either side of the lipid bilayer. The following figure shows the setup for the coarse-grain simulations. We placed the protein around 45-50 Å from the centre of the lipid bilayer and gave different orientations to keep the results unbiased. Our first step was to check the interaction of the fusion peptide with the lipid bilayer. We ran simulations for both R8-Smac(n7) and only Smac(n7).
Color code for the above image:
- Purple - Water molecules
- Dark blue and Pink - Head of lipids
- Aqua green - Tail of lipids
References
- T. Rivel, C. Ramseyer, S. O. Yesylevskyy, Permeation of cisplatin through the membranes of normal and cancer cells: a molecular dynamics study.
- Shahane, G., Ding, W., Palaiokostas, M. et al. Physical properties of model biological lipid bilayers: insights from all-atom molecular dynamics simulations. J Mol Model 25, 76 (2019). https://doi.org/10.1007/s00894-019-3964-0
- Marco Klähn, Martin Zacharias, Transformations in plasma membranes of cancerous cells and resulting consequences for cation insertion studied with molecular dynamics.
- Delin Sun, Jan Forsman, and Clifford E. Woodward, Atomistic Molecular Simulations Suggest a Kinetic Model for Membrane Translocation by Arginine-Rich Peptides.
Caspase-Cascade Machinery Kinetics
Description
The tumour necrosis factor-related apoptosis-inducing ligand (TRAIL) is regarded as a potential anticancer agent, especially for highly malignant tumours. Some cancer cells are resistant to apoptosis induced by TRAIL. Thus we are building these mathematical models to understand the rate of production of caspases due to TRAIL receptor activation to ensure apoptosis takes place due to the activation.Mechanism of apoptosis: Overview
Tumour necrosis factor-related apoptosis-inducing ligand (TRAIL) is a member of the TNF superfamily and has shown strong antitumor activity in a wide range of cancer cell types with minimal cytotoxicity to most normal cells and tissues. The tumour necrosis factor (TNF) superfamily consists of proteins involved in proliferation, differentiation, and apoptosis. TRAIL binds to several distinct receptors: (a) TRAIL-R1 (DR4/APO-2 A), (b) TRAIL-R2 (DR5/TRICK/Killer), TRAIL-R3 (DcR1/TRID/LIT) and similarly others bind to different receptors. Initially, the TRAIL ligand binds to its two death receptors DR4 (TRAIL-R1) and DR5 (TRAIL-R2). Death receptor cytoplasmic sequences contain a shared 80-amino acid death domain that, upon ligand binding, associates with a similar domain found in adaptor proteins such as FAS-associating protein with death domain (FADD) and TNF-related associated death domain (TRADD). FADD promotes the formation of a death-inducing signalling complex, DISC, which then binds to cysteine proteases (caspases) that cleave specific proteins. The two caspases predominantly bound to these adaptor molecules are caspase 8 and caspase 10. Caspase-8 or caspase 10 activation initiates a cascade where other caspases, including caspase-3, are activated, ultimately resulting in an irreversible commitment of cells to undergo apoptosis.The two pathways are:
- In the type, I pathway, activated caspase-8 directly cleaves and activates caspase-3.
- In the type II pathway, caspase-8 cleaves Bid into tBid to initiate the oligomerization of Bax and leads to the release of cytochrome C and Smac from the mitochondrion. Consuming ATP, cytochrome C binds to caspase-9 and Apaf-1 to form apoptosome, which finally cleaves and activates caspase-3/7. Bcl-2, FLICE-inhibitory protein (FLIP), and X-linked inhibitor of apoptosis protein (XIAP) are important regulators in this TRAIL-mediated apoptosis pathway. FLIP inhibits caspase-8 activation via competitive binding to DISC. Bcl-2 is shown to interact with both tBid and Bax to inhibit the type II pathway [9,10]. XIAP blocks caspase-3 and apoptosome but could be inhibited by Smac. In addition, Mcl-1 and Bim are assumed to be two important regulatory factors in TRAIL-mediated apoptosis. Previous data show that Mcl-1 sequestrants Bim on the mitochondrial membrane, although TRAIL-activated caspase-8 and caspase-3 cleave Mcl-1 to produce free Bim that mediates the release of cytochrome C from mitochondria in a Bax-dependent manner. In our project, we are trying to inject the SMAC through our bacteria which will internalize in the cancer cell membrane,l and do the apoptosis. The model of the same is illustrated.
Figure 1: Schematic description of the TRAIL signalling pathway
Death receptor (type I) and mitochondrion (type II) pathways of apoptosis constitute the basic structure of the interaction network in our schematic representation. To be simple, caspase-8 and -10 are represented in one molecule in our model because of their redundant function, so are Bcl-2/ Bcl-XL, caspase-3/7, IAPs, and Bax/Bak.This model is helpful for showing that for a cancer cell, given some amount of TRAIL activation, the model can predict the amount of caspase 3 produced, which can tell the certainty of apoptosis.
Methods
We used simple laws of Mass-action and Michaelis-Menten kinetics to create a mathematical model of the system and we have reproduced the results of paperPathways
The pathways for TRAIL induced apoptosis is given by the following flowchart diagramParameter data
Rate ConstantsInitial value of reactants
Results
We used COPASI to form the ODEs and solve them. We also augmented the Smac(n7)-R8internalisation kinetics model with this model and plotted graphs.Legend
- Pink - Activated Caspase 3
- Cyan - Caspase 3
- Orange - XIAP
References
- Zhang T, Wu M, Chen Q, Sun Z. Investigation into the regulation mechanisms of TRAIL apoptosis pathway by mathematical modelling. Acta Biochim Biophys Sin (Shanghai). 010 Feb;42(2):98-108. DOI: 10.1093/abbs/gmp114. PMID: 20119620.
- Stucki JW, Simon HU. Mathematical modelling of the regulation of caspase-3 activation and degradation. J Theor Biol. 2005 May 7;234(1):123-31. doi: 10.1016/j.jtbi.2004.11.011. Epub 2005 Jan 22. PMID: 15721041.
Kill Switch
Description and Working
As a part of biosafety, we designed a holin-antiholin kill switch that gets activated at low lactate concentrations. When the bacteria are injected into the body, they need to reach the tumour microenvironment and release TRAIL and Smac. Tumour microenvironments have a lactate concentration of 10-30 mM. To prevent the bacteria from releasing TRAIL and Smac in a non-tumour microenvironment we designed a gene cassette containing the bacteriophage derived lambda repressor (cI) fused to an LVA tag under the control of a lactate inducible promoter. In the presence of lactate antiholin and the lambda repressor will be expressed. The lambda repressor represses the expression of holin and endolysin through the lambda repressible promoter. In the absence of lactate, the kill switch needs to be activated. The lambda repressor gets degraded as it is LVA tagged. This activates the expression of holin and endolysin. The holin that is initially made is neutralized by the already present antiholin. Meanwhile, endolysin is building up in the cytosol. Once the holin overwhelms antiholin, holin starts to form holes in the membrane and the endolysin already present in the cytosol lyses the cell wall, effectively killing the cell. While designing our project, a major question we came up with was the time delay of kill switch activation in the absence of lactate/ low concentrations of lactate (non-tumour microenvironment). The bacteria must have enough time to circulate and localize (in case of the presence of multiple tumour sites) before it gets killed. Hence, we decided to model our kill switch and investigate the time delay as a checkpoint before we started our wet-lab experiments.Methods
The pathways and parameters involved in the working of the kill switch were input into COPASI (http://copasi.org) to obtain the ODEs.Data
Description | Parameter value | Reference |
---|---|---|
Production of holin | 479.3 uM/min | [1] |
Degradation of holin | 0.0348 min^-1 | [1] |
Degradation of LVA tagged lambda repressor | 0.018 min^-1 | [3] |
Association constant of holin-antiholin dimer | 120 M^-1 min^-1 | [1] |
Dissociation constant of holin-antiholin dimer | 3e-5 min^-1 | [1] |
Antiholin degradation rate | 0.0348 min^-1 | [1] |
Association rate constant for lambda repressor and operator | 2.8e7 M^-1 sec^-1 | [4] |
Dissociation rate constant for lambda repressor and operator | 0.022 sec^-1 | [4] |
Holin-antiholin dimer degradation rate | 0.0348 min^-1 | [1] |
Basal expression of lactate promoter | 479.3 uM/min | [1] |
Maximal transcription rate of cI controlled promoter | 0.00275 uM^-1 s^-1 | [2] |
Volume of compartment | 6e-15 L |
Graph
From the graph we can see that the time delay in kill switch activation, in the absence of lactate is around 20 minutes after which the antiholin concentration decreases, the holin concentration increases and lambda repressor concentration also decreases.
Conclusion
The modelled time delay of 20 minutes can be considered as an underestimation. This is mainly dueto the possibility of disparity in rates and expression data. The time delay in an actual biological context may vary. Since the time taken for one complete circulation is 1 minute, we can say that our modelled kill switch has a high chance of working effectively in a biological context.Wet Lab Results of Holin-Antiholin Kill Switch
We successfully ligated the Kill Switch Components (Holin-Endolysin and Antiholin-Lamba Repressor) into pMB1 Plasmid. Then DH5-𝛂 cells were transformed with this Kill Switch-pMB1 plasmid.Fig : Transformation of E. coli DH5-𝛂 with the Kill Switch (Holin-Antiholin-pMB1 ) and Plating in 50µg/mL Spectinomycin plates with : A) No lactate B) 3mM lactate C) 5mM lactate D)10mM lactate E)20mM lactate F) 40mM lactate
Observation and Interpretation of Result:
In 0mM lactate plates, the kill switch was operational, Holin and Endolysin were produced, killing the bacteria and preventing growth. Only one colony was observed in the 0mM lactate plate (could be an experimental error/ contamination). 3mM and 5mM lactate plates had fewer colonies, and 20 mM, 40mM lactate plates had a large number of colonies. At these lactate concentrations, antiholin and lambda repressor were produced, which inhibited the holin and endolysin. Thus bacteria were able to survive and form many colonies. There is a little bit of leakiness/ delay in the kill switch functioning. This could be the action of the lambda repressor, whose secretion is controlled by lactate. Lambda repressor will reduce Holin production by binding to the cL promoter. This allows us to deliver the bacteria via the intravenous route, as the lambda repressor will delay the action of the kill switch long enough for bacteria to localize to the tumor region. So our kill switch allows optimal bacterial growth from 10 to 40 mM lactate conditions, typically observed in solid tumors.CFU/mL = (No. of colonies * Total dilution factor)/Vol. of culture plated in mL
Dilution Factor = 2
Volume of culture plated in mL = 0.1 mL
OD Measure & Growth Curve of Bacteria with Kill Switch at different Lactate Concentrations
Table : OD measurement after inoculation 100 µL primary culture into 5mL fresh LB with 50µg/mL Spectinomycin and different lactate concentrations (0mM,1.5mM,5mM,10mM,20mM,40mM)
References
[1] https://parts.igem.org/Part:BBa_K3419005[2] https://2020.igem.org/Team:IISER_Bhopal/Model_killSwitch
[3] http://parts.igem.org/Part:BBa_K1399001
[4] Nelson HC, Sauer RT. Lambda repressor mutations that increase the affinity and specificity of operator binding. Cell. 1985 Sep;42(2):549-58. doi: 10.1016/0092-8674(85)90112-6. PMID: 3161621.
Structural Modelling of Fusion TRAIL
Background
In our project, we have constructed a polyprotein sequence that gets cleaved by enzymes specifically present in cancer cells. Hence, it is ideal to check that the cleaved and linker residues do not impact the structure of TRAIL and that the functional domains remain intact. For this, we structurally modelled both the native and fusion (after cleavage) TRAIL constructs.Protein folding
Protein folding is the process by which a linear amino acid sequence/ polypeptide folds into a three-dimensional structure and adopts its low energy native conformation. The three-dimensional structure is a combination of various secondary structures (alpha helices, beta sheets, random coils). The backbone and side-chain interactions propel the protein to fold into its native conformation.Methods and Servers
- I-TASSER: Iterative threading assembly refinement predicts tertiary structure by identifying PDB templates by multiple threading approaches
- PyMOL: Molecular visualization software that is maintained and distributed by Schrödinger.
- PSIPRED: Neural network-based method to predict secondary structure.
- MolProbity: MolProbity was used to generate Ramachandran plots. It is used to generate coordinates, graphics and numerical evaluations.
- Protein Data Bank: The Protein Data Bank (PDB) is a database for the deposition of three-dimensional structures of known protein structures and other large molecules like nucleic acids.
Evaluation Metrics
- C-score: C-score is an output metric of I-TASSER. It indicates the confidence of the prediction and its range is [-5, 2]. The threading template alignments and the convergence parameters of the simulations are taken into consideration to calculate it.
- RMSD: Root-mean-square deviation signifies how much two given structures deviate from each other and is the distance between the backbone atoms (usually).
- TM-score: Similar to RMSD but less sensitive to local modelling error.
- Ramachandran Maps: Map of phi-psi angle (torsional angles) showcasing the allowed and disallowed regions and the torsional angles taken up by the amino acids in the peptide.
TSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYY
IYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG
- Trail sequence with additional residues (cleavage by metalloproteinase) (referred to as fusion TRAIL in this document)
LAGRVVRTSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYI
YSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGA
FLVGGSGSGSHHHHHHGSGSGSLAYGSQGDLNPLINEISKIISAAGSFDVKEERTAASLLQLSGNASDFSYGRNSITLTTSA
Secondary structure analysis using psi-pred
NativeFusion
Results from the I-TASSER online server
The I-TASSER server provides the 5 best-predicted models. The confidence of each model is measured by the C-score that lies in the interval [-5, 2]. A higher C-score indicates a model predicted with higher confidence. Both native TRAIL and fusion TRAIL structures were predicted using I-TASSER.Shown below is the tertiary structure of native TRAIL as predicted by I-TASSER with C = - 0.56
Estimated TM-score = 0.64±0.13
Estimated RMSD = 6.4±3.9
Shown below is the tertiary structure of fusion TRAIL as predicted by I-TASSER with C = -2.89
Alignment using PyMOL
The alignments of fusion TRAIL from I-TASSER results were made using PyMOL with the crystal structure available on PDB to analyze if the structure deviated significantly due to the linker and cleaved residues. The RMSD value was obtained under acceptable limits. The beta-sheets aligned quite well while the rest of the protein being random coils did not align as expected.RMSD = 0.82 angstrom
Conclusion
From our structural model, we can quite clearly see that the structures of native and fusion TRAIL are quite similar. Hence, there is a high chance that the active and functionally relevant domains in our fusion construct TRAIL will remain the same as that of native TRAIL. The low RMSD values and significantly high confidence values reinforce the idea that the structure and thereby the function remains similar.References
- https://2020.igem.org/Team:IISER_Bhopal/Model_structural_model
- A Roy, A Kucukural, Y Zhang. I-TASSER: a unified platform for automated protein structure and function prediction. Nature Protocols, 5: 725-738 (2010).