Team:Tuebingen/cycs-found.html
Found Cyclotides
This page shows the source files which include the cyclotides we found using our HMM search.
Cyclotides from Solanaceae in Cybase >> JACAFL010121731.1 Petunia axillaris subsp. parodii cultivar S7 scaffold121731, whole genome shotgun sequence_chunk_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.5 10.1 3.1e-16 6.5e-10 1 30 [] 3355 3384 .. 3355 3384 .. 0.99 Alignments for each domain: == domain 1 score: 49.5 bits; conditional E-value: 3.1e-16 BCCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyrN 30 gipCGEsCv+ipCi+ v GCsC++k+CyrN JACAFL010121731.1 3355 GIPCGESCVWIPCISGVQGCSCSNKICYRN 3384 7****************************9 PP >> JAFBXY010025767.1 Petunia secreta isolate 01A Psec_k119Scf2432035, whole genome shotgun sequence_chunk_0_F2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 45.3 10.5 6.4e-15 1.3e-08 4 30 .] 679 705 .. 676 705 .. 0.96 Alignments for each domain: == domain 1 score: 45.3 bits; conditional E-value: 6.4e-15 CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVCyrN 30 CGEsCv+ipC++a++GCsC++k+CyrN JAFBXY010025767.1 679 CGESCVWIPCVSAAIGCSCSNKICYRN 705 **************************9 PP >> JACAFL010060734.1 Petunia axillaris subsp. parodii cultivar S7 scaffold60734, whole genome shotgun sequence_chunk_0_ # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.4 11.1 5.3e-09 0.011 1 22 [. 6181 6202 .. 6181 6203 .. 0.95 Alignments for each domain: == domain 1 score: 26.4 bits; conditional E-value: 5.3e-09 BCCCCEE-SSSS-SGGCCTEEE CS Cyclotide 1 gipCGEsCvyipCitavlGCsC 22 gi CGEsCv+ipC++a++GCsC JACAFL010060734.1 6181 GIGCGESCVWIPCVSAAIGCSC 6202 789******************* PP Cyclotides from Viola pubescens in Cybase >> NBIL01011608.1 Viola pubescens var. scabriuscula 5046050, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.8 9.8 1.6e-17 8.8e-14 2 30 .] 26 54 .. 24 54 .. 0.97 Alignments for each domain: == domain 1 score: 56.8 bits; conditional E-value: 1.6e-17 CCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVCyrN 30 ipCGEsCv+ipCi+a++GCsCk+kVCyrN NBIL01011608.1 26 IPCGESCVFIPCISAAIGCSCKNKVCYRN 54 9***************************9 PP >> NBIL01075038.1 Viola pubescens var. scabriuscula 5151180, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.0 9.8 3e-17 1.6e-13 2 30 .] 13 41 .. 11 41 .. 0.97 Alignments for each domain: == domain 1 score: 56.0 bits; conditional E-value: 3e-17 CCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVCyrN 30 ipCGEsCv+ipCi+a++GCsCk+kVCyrN NBIL01075038.1 13 IPCGESCVFIPCISAAIGCSCKNKVCYRN 41 9***************************9 PP >> NBIL01096509.1 Viola pubescens var. scabriuscula 5186959, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.2 10.9 2.5e-17 1.4e-13 2 30 .] 141 169 .. 139 169 .. 0.97 Alignments for each domain: == domain 1 score: 56.2 bits; conditional E-value: 2.5e-17 CCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVCyrN 30 ipCGEsCv+ipCi++v+GCsCk+kVCyrN NBIL01096509.1 141 IPCGESCVFIPCISSVVGCSCKNKVCYRN 169 9***************************9 PP >> NBIL01117794.1 Viola pubescens var. scabriuscula 5222147, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 55.0 10.8 5.9e-17 3.2e-13 2 30 .] 216 244 .. 214 244 .. 0.97 Alignments for each domain: == domain 1 score: 55.0 bits; conditional E-value: 5.9e-17 CCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVCyrN 30 ipCGEsCv+ipCi++v+GCsCk+kVCyrN NBIL01117794.1 216 IPCGESCVFIPCISSVVGCSCKSKVCYRN 244 9***************************9 PP >> NBIL01132660.1 Viola pubescens var. scabriuscula 5244788, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 55.4 11.8 4.4e-17 2.4e-13 2 30 .] 21 49 .. 19 49 .. 0.97 Alignments for each domain: == domain 1 score: 55.4 bits; conditional E-value: 4.4e-17 CCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVCyrN 30 ipCGEsCv+ipCit+v+GCsCk+kVCy+N NBIL01132660.1 21 IPCGESCVFIPCITSVVGCSCKSKVCYKN 49 89**************************9 PP >> NBIL01128065.1 Viola pubescens var. scabriuscula 5239218, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 8.9 1.0 0.015 84 19 30 .] 1 12 [. 1 12 [. 0.94 2 ! 33.9 11.8 2.3e-10 1.3e-06 1 30 [] 38 66 .. 38 66 .. 0.95 3 ! 18.6 9.4 1.5e-05 0.08 1 30 [] 92 120 .. 92 120 .. 0.93 Alignments for each domain: == domain 1 score: 8.9 bits; conditional E-value: 0.015 TEEEETTEEEET CS Cyclotide 19 GCsCkdkVCyrN 30 GC+C+ VC+rN NBIL01128065.1 1 GCTCSWPVCTRN 12 9***988****9 PP >> NBIL01018215.1 Viola pubescens var. scabriuscula 5057028, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 24.9 5.6 1.5e-07 0.00084 13 30 .] 1 18 [. 1 18 [. 0.98 Alignments for each domain: == domain 1 score: 24.9 bits; conditional E-value: 1.5e-07 -SGGCCTEEEETTEEEET CS Cyclotide 13 CitavlGCsCkdkVCyrN 30 C+t+++GCsCk+kVCyrN NBIL01018215.1 1 CLTSAIGCSCKSKVCYRN 18 9****************9 PP >> NBIL01010979.1 Viola pubescens var. scabriuscula 5044991, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.5 5.6 9.5e-08 0.00052 13 30 .] 1 18 [. 1 18 [. 0.99 2 ? 1.8 2.0 2.5 1.4e+04 11 23 .. 62 74 .. 61 79 .. 0.85 Alignments for each domain: == domain 1 score: 25.5 bits; conditional E-value: 9.5e-08 -SGGCCTEEEETTEEEET CS Cyclotide 13 CitavlGCsCkdkVCyrN 30 C+t+++GCsCk+kVCyrN NBIL01010979.1 1 CLTSAIGCSCKSKVCYRN 18 9****************9 PP >> NBIL01044212.1 Viola pubescens var. scabriuscula 5100137, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 19.9 5.5 5.6e-06 0.03 1 13 [. 245 257 .] 245 257 .] 0.98 Alignments for each domain: == domain 1 score: 19.9 bits; conditional E-value: 5.6e-06 BCCCCEE-SSSS- CS Cyclotide 1 gipCGEsCvyipC 13 gipCGEsCv+ipC NBIL01044212.1 245 GIPCGESCVFIPC 257 8************ PP >> NBIL01029770.1 Viola pubescens var. scabriuscula 5076125, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.1 4.6 0.00017 0.94 11 30 .] 2 19 .. 1 19 [. 0.93 Alignments for each domain: == domain 1 score: 15.1 bits; conditional E-value: 0.00017 SS-SGGCCTEEEETTEEEET CS Cyclotide 11 ipCitavlGCsCkdkVCyrN 30 ++C +++GCsC+ VC+rN NBIL01029770.1 2 GTC--NTPGCSCSWPVCTRN 19 79*..*******988****9 PP Our Antibacterial Solanaceae in Cybase >> JAFBXY010025767.1 Petunia secreta isolate 01A Psec_k119Scf2432035, whole genome shotgun sequence_chunk_0_F2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.8 13.3 7.2e-17 1e-10 4 30 .] 679 705 .. 676 705 .. 0.97 Alignments for each domain: == domain 1 score: 51.8 bits; conditional E-value: 7.2e-17 Alignment 4 CGESCVfIPCisallGCSCKsKVCYrN 30 CGESCV+IPC+sa++GCSC +K+CYrN JAFBXY010025767.1 679 CGESCVWIPCVSAAIGCSCSNKICYRN 705 **************************9 PP >> JACAFL010121731.1 Petunia axillaris subsp. parodii cultivar S7 scaffold121731, whole genome shotgun sequence_chunk_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.0 4.9 7e+06 15 28 .. 2288 2301 .. 2287 2301 .. 0.86 2 ! 53.3 14.0 2.4e-17 3.5e-11 1 30 [] 3355 3384 .. 3355 3384 .. 0.98 == domain 2 score: 53.3 bits; conditional E-value: 2.4e-17 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 +IPCGESCV+IPCis + GCSC +K+CYrN JACAFL010121731.1 3355 GIPCGESCVWIPCISGVQGCSCSNKICYRN 3384 7****************************9 PP >> JACAFL010060734.1 Petunia axillaris subsp. parodii cultivar S7 scaffold60734, whole genome shotgun sequence_chunk_0_ # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.4 14.2 3.4e-10 0.00049 1 22 [. 6181 6202 .. 6181 6203 .. 0.96 Alignments for each domain: == domain 1 score: 30.4 bits; conditional E-value: 3.4e-10 Alignment 1 sIPCGESCVfIPCisallGCSC 22 +I CGESCV+IPC+sa++GCSC JACAFL010060734.1 6181 GIGCGESCVWIPCVSAAIGCSC 6202 699******************* PP >> JACAFL010007464.1 Petunia axillaris subsp. parodii cultivar S7 scaffold7464, whole genome shotgun sequence_chunk_0_F # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 23.5 11.5 5.1e-08 0.073 1 27 [. 597 623 .. 597 625 .. 0.91 2 ? -1.1 1.1 2.5 3.6e+06 9 14 .. 2303 2308 .. 2302 2310 .. 0.87 == domain 2 score: -1.1 bits; conditional E-value: 2.5 Alignment 9 VfIPCi 14 V+IPC JACAFL010007464.1 2303 VWIPCF 2308 9****6 PP >> PGPE01380667.1 Nicotiana glauca isolate Gk001 jcf7180010617752, whole genome shotgun sequence_chunk_0_F0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 5.7 0.5 0.019 2.7e+04 7 12 .. 1 6 [. 1 7 [. 0.94 2 ? 5.4 0.0 0.024 3.4e+04 6 12 .. 43 49 .. 41 52 .. 0.87 3 ? 7.9 0.1 0.0038 5.5e+03 6 12 .. 140 146 .. 138 150 .. 0.85 Alignments for each domain: == domain 1 score: 5.7 bits; conditional E-value: 0.019 Alignment 7 SCVfIP 12 SCV+IP PGPE01380667.1 1 SCVWIP 6 9****9 PP >> MDKG01469402.1 Nicotiana rustica Nrus_contig218731, whole genome shotgun sequence_chunk_0_F1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 3.5 0.1 0.089 1.3e+05 6 11 .. 25 30 .. 21 32 .. 0.89 2 ? 11.0 0.0 0.00039 5.6e+02 17 29 .. 83 95 .. 81 96 .. 0.90 Alignments for each domain: == domain 1 score: 3.5 bits; conditional E-value: 0.089 Alignment 6 ESCVfI 11 ESCVf+ MDKG01469402.1 25 ESCVFL 30 9****6 PP Our antibacterial Viola Pubescens in Cybase >> NBIL01011608.1 Viola pubescens var. scabriuscula 5046050, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 70.5 13.6 3.7e-22 3.8e-18 1 30 [] 25 54 .. 25 54 .. 0.98 Alignments for each domain: == domain 1 score: 70.5 bits; conditional E-value: 3.7e-22 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 +IPCGESCVfIPCisa++GCSCK+KVCYrN NBIL01011608.1 25 VIPCGESCVFIPCISAAIGCSCKNKVCYRN 54 7****************************9 PP >> NBIL01075038.1 Viola pubescens var. scabriuscula 5151180, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.6 13.6 6.9e-22 7e-18 1 30 [] 12 41 .. 12 41 .. 0.98 Alignments for each domain: == domain 1 score: 69.6 bits; conditional E-value: 6.9e-22 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 +IPCGESCVfIPCisa++GCSCK+KVCYrN NBIL01075038.1 12 VIPCGESCVFIPCISAAIGCSCKNKVCYRN 41 7****************************9 PP >> NBIL01096509.1 Viola pubescens var. scabriuscula 5186959, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.5 15.5 3.1e-21 3.1e-17 1 30 [] 140 169 .. 140 169 .. 0.98 Alignments for each domain: == domain 1 score: 67.5 bits; conditional E-value: 3.1e-21 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 +IPCGESCVfIPCis+++GCSCK+KVCYrN NBIL01096509.1 140 VIPCGESCVFIPCISSVVGCSCKNKVCYRN 169 7****************************9 PP >> NBIL01132660.1 Viola pubescens var. scabriuscula 5244788, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.8 15.9 4.6e-20 4.7e-16 2 30 .] 21 49 .. 20 49 .. 0.98 Alignments for each domain: == domain 1 score: 63.8 bits; conditional E-value: 4.6e-20 Alignment 2 IPCGESCVfIPCisallGCSCKsKVCYrN 30 IPCGESCVfIPCi +++GCSCKsKVCY+N NBIL01132660.1 21 IPCGESCVFIPCITSVVGCSCKSKVCYKN 49 9***************************9 PP >> NBIL01018215.1 Viola pubescens var. scabriuscula 5057028, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.6 8.1 2.3e-09 2.3e-05 13 30 .] 1 18 [. 1 18 [. 0.98 Alignments for each domain: == domain 1 score: 29.6 bits; conditional E-value: 2.3e-09 Alignment 13 CisallGCSCKsKVCYrN 30 C +++GCSCKsKVCYrN NBIL01018215.1 1 CLTSAIGCSCKSKVCYRN 18 999**************9 PP >> NBIL01010979.1 Viola pubescens var. scabriuscula 5044991, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.2 8.1 1.4e-09 1.5e-05 13 30 .] 1 18 [. 1 18 [. 0.98 Alignments for each domain: == domain 1 score: 30.2 bits; conditional E-value: 1.4e-09 Alignment 13 CisallGCSCKsKVCYrN 30 C +++GCSCKsKVCYrN NBIL01010979.1 1 CLTSAIGCSCKSKVCYRN 18 999**************9 PP >> NBIL01044212.1 Viola pubescens var. scabriuscula 5100137, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.8 7.9 2.9e-07 0.003 1 13 [. 245 257 .] 245 257 .] 0.97 Alignments for each domain: == domain 1 score: 22.8 bits; conditional E-value: 2.9e-07 Alignment 1 sIPCGESCVfIPC 13 +IPCGESCVfIPC NBIL01044212.1 245 GIPCGESCVFIPC 257 7************ PP >> NBIL01153757.1 Viola pubescens var. scabriuscula 5266765, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 17.1 8.4 1.8e-05 0.19 18 30 .] 1 13 [. 1 13 [. 0.96 Alignments for each domain: == domain 1 score: 17.1 bits; conditional E-value: 1.8e-05 Alignment 18 lGCSCKsKVCYrN 30 +GCSCKsKVCY+N NBIL01153757.1 1 VGCSCKSKVCYKN 13 6***********9 PP
Cyclotides from Solanaceae not in Cybase >> JAFBXY010011193.1 Petunia secreta isolate 01A Psec_k119Scf2366595, whole genome shotgun sequence_chunk_0_F2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 48.6 10.5 6e-16 1.2e-09 1 30 [] 3089 3119 .. 3089 3119 .. 0.98 Alignments for each domain: == domain 1 score: 48.6 bits; conditional E-value: 6e-16 BCCCCEE-SSSS-.SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipC.itavlGCsCkdkVCyrN 30 gipCGEsCv+ipC ta+lGCsC++k+Cy+N JAFBXY010011193.1 3089 GIPCGESCVWIPCtTTALLGCSCSNKICYKN 3119 7*****************************9 PP >> JAFBXY010004347.1 Petunia secreta isolate 01A Psec_k119Scf2413791, whole genome shotgun sequence_chunk_0_F1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 41.6 11.1 9.7e-14 2e-07 1 30 [] 4232 4261 .. 4232 4261 .. 0.98 Alignments for each domain: == domain 1 score: 41.6 bits; conditional E-value: 9.7e-14 BCCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyrN 30 gipCG sC++ipCi++++GCsC++kVCy N JAFBXY010004347.1 4232 GIPCGKSCIWIPCISSTVGCSCRNKVCYSN 4261 7***************************98 PP >> JACAFL010018638.1 Petunia axillaris subsp. parodii cultivar S7 scaffold18638, whole genome shotgun sequence_chunk_0_ # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 41.1 9.0 1.4e-13 2.8e-07 1 30 [] 5359 5388 .. 5359 5388 .. 0.95 Alignments for each domain: == domain 1 score: 41.1 bits; conditional E-value: 1.4e-13 BCCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyrN 30 g+ CGEsCv+ipC++a +GCsC++ +Cy+N JACAFL010018638.1 5359 GLICGESCVWIPCLSASIGCSCSNMICYLN 5388 577*************************98 PP >> JAFBXY010008453.1 Petunia secreta isolate 01A Psec_k119Scf2398299, whole genome shotgun sequence_chunk_0_F1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.4 10.0 8.4e-12 1.7e-05 3 29 .. 7478 7505 .. 7476 7506 .. 0.94 Alignments for each domain: == domain 1 score: 35.4 bits; conditional E-value: 8.4e-12 CCCEE-SSSS-.SGGCCTEEEETTEEEE CS Cyclotide 3 pCGEsCvyipC.itavlGCsCkdkVCyr 29 CGEsC +ipC +ta++GC C++kVC + JAFBXY010008453.1 7478 TCGESCLWIPCtVTAAFGCYCSNKVCVK 7505 5*************************87 PP >> JACAFL010092276.1 Petunia axillaris subsp. parodii cultivar S7 scaffold92276, whole genome shotgun sequence_chunk_0_ # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.8 9.0 1.1e-10 0.00023 3 29 .. 2442 2469 .. 2440 2470 .. 0.94 Alignments for each domain: == domain 1 score: 31.8 bits; conditional E-value: 1.1e-10 CCCEE-SSSS-.SGGCCTEEEETTEEEE CS Cyclotide 3 pCGEsCvyipC.itavlGCsCkdkVCyr 29 CGE CvyipC ita+lGCsC +kVC r JACAFL010092276.1 2442 DCGEPCVYIPCtITALLGCSCLNKVCVR 2469 5*************************86 PP >> JAFBXY010041265.1 Petunia secreta isolate 01A Psec_k119Scf2416639, whole genome shotgun sequence_chunk_0_F2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.9 10.7 2.2e-10 0.00045 1 27 [. 1128 1154 .. 1128 1157 .. 0.92 Alignments for each domain: == domain 1 score: 30.9 bits; conditional E-value: 2.2e-10 BCCCCEE-SSSS-SGGCCTEEEETTEE CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVC 27 +i+C+EsCv+ipC t+++GCsC ++ C JAFBXY010041265.1 1128 SISCAESCVWIPCATSLIGCSCVNSRC 1154 599*******************99877 PP Alignments for each domain: == domain 1 score: 3.2 bits; conditional E-value: 0.099 CCCEE-SSS CS Cyclotide 3 pCGEsCvyi 11 pCG +C+++ AWOL01S0181073.1 65 PCGATCMML 73 9*****986 PP >> JACAFL010186355.1 Petunia axillaris subsp. parodii cultivar S7 scaffold187367, whole genome shotgun sequence_chunk_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 19.5 4.7 7.7e-07 1.6 11 29 .. 1 20 [. 1 21 [. 0.94 Alignments for each domain: == domain 1 score: 19.5 bits; conditional E-value: 7.7e-07 SS-.SGGCCTEEEETTEEEE CS Cyclotide 11 ipC.itavlGCsCkdkVCyr 29 ipC +ta++GC C++kVC + JACAFL010186355.1 1 IPCtVTAAFGCYCSNKVCVK 20 8*****************87 PP >> JACAFL010007464.1 Petunia axillaris subsp. parodii cultivar S7 scaffold7464, whole genome shotgun sequence_chunk_0_F # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 19.9 11.3 5.9e-07 1.2 1 25 [. 597 621 .. 597 625 .. 0.89 Alignments for each domain: == domain 1 score: 19.9 bits; conditional E-value: 5.9e-07 BCCCCEE-SSSS-SGGCCTEEEETT CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdk 25 +i C EsC +ipC ta++GCsC + JACAFL010007464.1 597 SITCIESCLFIPCATAIIGCSCING 621 589*******************775 PP >> AWOL01S0542339.1 Nicotiana otophora Noto_scaffold542339, whole genome shotgun sequence_chunk_0_F1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.1 2.7 2.1e-06 4.4 7 28 .. 9 29 .. 8 30 .. 0.93 Alignments for each domain: == domain 1 score: 18.1 bits; conditional E-value: 2.1e-06 E-SSSS-SGGCCTEEEETTEEE CS Cyclotide 7 sCvyipCitavlGCsCkdkVCy 28 sC++ + t +GC C+dk+C AWOL01S0542339.1 9 SCFTTKI-TLRIGCACNDKLCE 29 9***998.*************5 PP >> JAFBXY010047406.1 Petunia secreta isolate 01A Psec_k119Scf2425175, whole genome shotgun sequence_chunk_0_F0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.5 1.8 1.4e-05 28 3 28 .. 947 972 .. 944 974 .. 0.92 Alignments for each domain: == domain 1 score: 15.5 bits; conditional E-value: 1.4e-05 CCCEE-SSSS-SGGCCTEEEETTEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCy 28 CG sC++ip ++ ++G C +k C JAFBXY010047406.1 947 TCGGSCIWIPYLSGIAGYHCVNKMCV 972 6************************6 PP >> WBIH01386574.1 Solanum x curtilobum cur_386574, whole genome shotgun sequence_chunk_0_F2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 16.6 4.6 6.1e-06 13 5 26 .. 212 231 .. 207 233 .. 0.92 Alignments for each domain: == domain 1 score: 16.6 bits; conditional E-value: 6.1e-06 CEE-SSSS-SGGCCTEEEETTE CS Cyclotide 5 GEsCvyipCitavlGCsCkdkV 26 GEsC+ pC ++ CsC+ k+ WBIH01386574.1 212 GESCIKTPC--VAPKCSCTQKI 231 9********..*******9875 PP >> WBIH01202594.1 Solanum x curtilobum cur_202594, whole genome shotgun sequence_chunk_0_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.9 2.2 1.1e-05 22 7 24 .. 179 196 .. 175 196 .. 0.89 Alignments for each domain: == domain 1 score: 15.9 bits; conditional E-value: 1.1e-05 E-SSSS-SGGCCTEEEET CS Cyclotide 7 sCvyipCitavlGCsCkd 24 + ++i+Ci++++GCsCkd WBIH01202594.1 179 TSFIISCISSLVGCSCKD 196 5699************97 PP >> WBIA01102802.1 Solanum ahanhuiri ajh_102802, whole genome shotgun sequence_chunk_0_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.7 2.2 1.2e-05 24 7 24 .. 197 214 .. 193 214 .. 0.89 Alignments for each domain: == domain 1 score: 15.7 bits; conditional E-value: 1.2e-05 E-SSSS-SGGCCTEEEET CS Cyclotide 7 sCvyipCitavlGCsCkd 24 + ++i+Ci++++GCsCkd WBIA01102802.1 197 TSFIISCISSLVGCSCKD 214 5699************97 PP Cyclotides from Viola pubescens not in Cybase Domain annotation for each sequence (and alignments): >> NBIL01070120.1 Viola pubescens var. scabriuscula 5143085, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.8 11.6 5.3e-10 2.9e-06 1 30 [] 768 796 .. 768 796 .. 0.95 2 ! 32.8 11.6 5.3e-10 2.9e-06 1 30 [] 821 849 .. 821 849 .. 0.95 3 ! 32.8 11.6 5.3e-10 2.9e-06 1 30 [] 875 903 .. 875 903 .. 0.95 Alignments for each domain: == domain 1 score: 32.8 bits; conditional E-value: 5.3e-10 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GCsC+ VC+rN NBIL01070120.1 768 GLPiCGETCVGGTC--NTPGCSCSWPVCTRN 796 6899**********..*******988****9 PP == domain 2 score: 32.8 bits; conditional E-value: 5.3e-10 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GCsC+ VC+rN NBIL01070120.1 821 GLPiCGETCVGGTC--NTPGCSCSWPVCTRN 849 6899**********..*******988****9 PP == domain 3 score: 32.8 bits; conditional E-value: 5.3e-10 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GCsC+ VC+rN NBIL01070120.1 875 GLPiCGETCVGGTC--NTPGCSCSWPVCTRN 903 6899**********..*******988****9 PP >> NBIL01088637.1 Viola pubescens var. scabriuscula 5173981, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.3 12.6 3.1e-09 1.7e-05 1 30 [] 557 585 .. 557 585 .. 0.95 2 ! 31.2 10.1 1.7e-09 9.1e-06 1 30 [] 611 639 .. 611 639 .. 0.95 3 ! 29.4 13.1 5.8e-09 3.2e-05 1 30 [] 666 694 .. 666 694 .. 0.95 Alignments for each domain: == domain 1 score: 30.3 bits; conditional E-value: 3.1e-09 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GC+C+ VC rN NBIL01088637.1 557 GVPvCGETCVGGTC--NTPGCTCTWPVCSRN 585 6899**********..*******999***99 PP == domain 2 score: 31.2 bits; conditional E-value: 1.7e-09 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+C +++C +++GCsC+ +C+rN NBIL01088637.1 611 GLPvCGETCTLGTC--NTPGCSCSWPICMRN 639 6899**********..*******988****9 PP == domain 3 score: 29.4 bits; conditional E-value: 5.8e-09 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GC+C+ VC +N NBIL01088637.1 666 GVPiCGETCVGGTC--NTPGCTCTWPVCSKN 694 6899**********..*******999***99 PP >> NBIL01157303.1 Viola pubescens var. scabriuscula 5270322, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.4 9.6 2.2e-17 1.2e-13 1 30 [] 28 57 .. 28 57 .. 0.98 2 ! 19.4 6.4 8.1e-06 0.044 4 30 .] 642 668 .. 639 668 .. 0.93 Alignments for each domain: == domain 1 score: 56.4 bits; conditional E-value: 2.2e-17 BCCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyrN 30 gipCGEsCvyipC+ta++GCsCk kVCyrN NBIL01157303.1 28 GIPCGESCVYIPCLTAAIGCSCKKKVCYRN 57 7****************************9 PP == domain 2 score: 19.4 bits; conditional E-value: 8.1e-06 CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVCyrN 30 CGE+Cv +p ++++ GC C + C +N NBIL01157303.1 642 CGETCVSFPYFSSARGCGCHNLGCIKN 668 *******************99888887 PP >> NBIL01029989.1 Viola pubescens var. scabriuscula 5076473, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.5 9.7 1.1e-18 6.1e-15 1 30 [] 14 43 .. 14 43 .. 0.99 Alignments for each domain: == domain 1 score: 60.5 bits; conditional E-value: 1.1e-18 BCCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyrN 30 gipCGEsCv+ipCit v+GCsCk+kVCyrN NBIL01029989.1 14 GIPCGESCVWIPCITRVIGCSCKSKVCYRN 43 8****************************9 PP >> NBIL01033829.1 Viola pubescens var. scabriuscula 5082919, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 17.4 9.9 3.4e-05 0.19 2 30 .] 90 117 .. 89 117 .. 0.92 2 ! 23.4 7.7 4.6e-07 0.0025 1 30 [] 143 171 .. 143 171 .. 0.95 3 ! 31.5 14.8 1.3e-09 6.9e-06 2 30 .] 198 225 .. 196 225 .. 0.93 Alignments for each domain: == domain 1 score: 17.4 bits; conditional E-value: 3.4e-05 CC.CCEE-SSSS-SGGCCTEEEETT..EEEET CS Cyclotide 2 ip.CGEsCvyipCitavlGCsCkdk..VCyrN 30 +p CG +Cv +C ++lGCsC + +C rN NBIL01033829.1 90 LPiCGDTCVGETC--NALGCSC--S*pICIRN 117 788**********..*******..99999988 PP == domain 2 score: 23.4 bits; conditional E-value: 4.6e-07 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p C E+ + ++C +++GCsC+ VC+rN NBIL01033829.1 143 GLPiCSETSIGGTC--NTPGCSCSWPVCTRN 171 6899**********..*******988****9 PP == domain 3 score: 31.5 bits; conditional E-value: 1.3e-09 CC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ip.CGEsCvyipCitavlGCsCkdkVCyrN 30 +p CGE+Cv ++C +++GCsC+ VC+rN NBIL01033829.1 198 LPvCGETCVGGTC--YTPGCSCSWPVCTRN 225 577**********..*******988****9 PP >> NBIL01010784.1 Viola pubescens var. scabriuscula 5044658, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.4 11.7 6.8e-10 3.7e-06 1 30 [] 676 704 .. 676 704 .. 0.95 2 ! 31.9 11.9 9.7e-10 5.3e-06 1 30 [] 733 761 .. 733 761 .. 0.95 Alignments for each domain: == domain 1 score: 32.4 bits; conditional E-value: 6.8e-10 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GCsC+ VC+rN NBIL01010784.1 676 GLPvCGETCVGGTC--NTPGCSCSWPVCTRN 704 6899**********..*******988****9 PP == domain 2 score: 31.9 bits; conditional E-value: 9.7e-10 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GC+C+ VC+rN NBIL01010784.1 733 GLPvCGETCVGGTC--NTPGCTCSWPVCTRN 761 6899**********..*******988****9 PP >> NBIL01137078.1 Viola pubescens var. scabriuscula 5249481, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.4 11.7 6.8e-10 3.7e-06 1 30 [] 683 711 .. 683 711 .. 0.95 2 ! 31.9 11.9 9.8e-10 5.4e-06 1 30 [] 740 768 .. 740 768 .. 0.95 Alignments for each domain: == domain 1 score: 32.4 bits; conditional E-value: 6.8e-10 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GCsC+ VC+rN NBIL01137078.1 683 GLPvCGETCVGGTC--NTPGCSCSWPVCTRN 711 6899**********..*******988****9 PP == domain 2 score: 31.9 bits; conditional E-value: 9.8e-10 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GC+C+ VC+rN NBIL01137078.1 740 GLPvCGETCVGGTC--NTPGCTCSWPVCTRN 768 6899**********..*******988****9 PP >> NBIL01054408.1 Viola pubescens var. scabriuscula 5117130, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 57.2 8.7 1.2e-17 6.5e-14 1 30 [] 111 140 .. 111 140 .. 0.97 Alignments for each domain: == domain 1 score: 57.2 bits; conditional E-value: 1.2e-17 BCCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyrN 30 g pCGEsCv+ipCi+a++GCsCk+kVCyrN NBIL01054408.1 111 GMPCGESCVWIPCISAAVGCSCKSKVCYRN 140 68***************************9 PP >> NBIL01118700.1 Viola pubescens var. scabriuscula 5223704, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.7 9.9 5.6e-05 0.3 2 30 .] 353 380 .. 352 380 .. 0.92 2 ! 22.7 7.7 7.6e-07 0.0041 1 30 [] 406 434 .. 406 434 .. 0.95 3 ! 30.9 14.8 2.1e-09 1.1e-05 2 30 .] 461 488 .. 459 488 .. 0.93 Alignments for each domain: == domain 1 score: 16.7 bits; conditional E-value: 5.6e-05 CC.CCEE-SSSS-SGGCCTEEEETT..EEEET CS Cyclotide 2 ip.CGEsCvyipCitavlGCsCkdk..VCyrN 30 +p CG +Cv +C ++lGCsC + +C rN NBIL01118700.1 353 LPiCGDTCVGETC--NALGCSC--S*pICIRN 380 788**********..*******..99999988 PP == domain 2 score: 22.7 bits; conditional E-value: 7.6e-07 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p C E+ + ++C +++GCsC+ VC+rN NBIL01118700.1 406 GLPiCSETSIGGTC--NTPGCSCSWPVCTRN 434 6899**********..*******988****9 PP == domain 3 score: 30.9 bits; conditional E-value: 2.1e-09 CC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ip.CGEsCvyipCitavlGCsCkdkVCyrN 30 +p CGE+Cv ++C +++GCsC+ VC+rN NBIL01118700.1 461 LPvCGETCVGGTC--YTPGCSCSWPVCTRN 488 577**********..*******988****9 PP >> NBIL01132947.1 Viola pubescens var. scabriuscula 5245092, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 15.1 10.3 0.00018 0.96 4 30 .] 3 27 .. 1 27 [. 0.92 2 ! 23.2 7.7 5.3e-07 0.0029 1 30 [] 53 81 .. 53 81 .. 0.95 3 ! 31.3 14.8 1.5e-09 8e-06 2 30 .] 108 135 .. 106 135 .. 0.93 Alignments for each domain: == domain 1 score: 15.1 bits; conditional E-value: 0.00018 CCEE-SSSS-SGGCCTEEEETT..EEEET CS Cyclotide 4 CGEsCvyipCitavlGCsCkdk..VCyrN 30 CG +Cv +C ++lGCsC + +C rN NBIL01132947.1 3 CGDTCVGETC--NALGCSC--S*pICIRN 27 **********..*******..99999988 PP == domain 2 score: 23.2 bits; conditional E-value: 5.3e-07 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p C E+ + ++C +++GCsC+ VC+rN NBIL01132947.1 53 GLPiCSETSIGGTC--NTPGCSCSWPVCTRN 81 6899**********..*******988****9 PP == domain 3 score: 31.3 bits; conditional E-value: 1.5e-09 CC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ip.CGEsCvyipCitavlGCsCkdkVCyrN 30 +p CGE+Cv ++C +++GCsC+ VC+rN NBIL01132947.1 108 LPvCGETCVGGTC--YTPGCSCSWPVCTRN 135 577**********..*******988****9 PP >> NBIL01000609.1 Viola pubescens var. scabriuscula 431533, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.3 11.9 1.7e-10 9.4e-07 4 30 .] 2 26 .. 1 26 [. 0.97 2 ! 33.2 10.6 3.9e-10 2.1e-06 1 30 [] 53 81 .. 53 81 .. 0.95 Alignments for each domain: == domain 1 score: 34.3 bits; conditional E-value: 1.7e-10 CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVCyrN 30 CGE+C++++C +++GCsC+ +C+rN NBIL01000609.1 2 CGETCFTGKC--YTPGCSCSYPICKRN 26 **********..*******999****9 PP == domain 2 score: 33.2 bits; conditional E-value: 3.9e-10 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+C+ ++C +++GCsC VC rN NBIL01000609.1 53 GLPvCGETCFGGTC--NTPGCSCGWPVCLRN 81 6899**********..*******989**999 PP >> NBIL01038969.1 Viola pubescens var. scabriuscula 5091425, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 57.3 10.0 1.1e-17 6.1e-14 2 30 .] 29 57 .. 27 57 .. 0.97 Alignments for each domain: == domain 1 score: 57.3 bits; conditional E-value: 1.1e-17 CCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVCyrN 30 +pCGEsCv+ipCita++GCsCk+kVCy+N NBIL01038969.1 29 VPCGESCVWIPCITAAIGCSCKSKVCYKN 57 79**************************9 PP >> NBIL01132946.1 Viola pubescens var. scabriuscula 5245091, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 15.0 10.3 0.00018 1 4 30 .] 3 27 .. 1 27 [. 0.92 2 ! 23.1 7.7 5.5e-07 0.003 1 30 [] 53 81 .. 53 81 .. 0.95 3 ! 31.3 14.8 1.5e-09 8.3e-06 2 30 .] 108 135 .. 106 135 .. 0.93 Alignments for each domain: == domain 1 score: 15.0 bits; conditional E-value: 0.00018 CCEE-SSSS-SGGCCTEEEETT..EEEET CS Cyclotide 4 CGEsCvyipCitavlGCsCkdk..VCyrN 30 CG +Cv +C ++lGCsC + +C rN NBIL01132946.1 3 CGDTCVGETC--NALGCSC--S*pICIRN 27 **********..*******..99999988 PP == domain 2 score: 23.1 bits; conditional E-value: 5.5e-07 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p C E+ + ++C +++GCsC+ VC+rN NBIL01132946.1 53 GLPiCSETSIGGTC--NTPGCSCSWPVCTRN 81 6899**********..*******988****9 PP == domain 3 score: 31.3 bits; conditional E-value: 1.5e-09 CC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ip.CGEsCvyipCitavlGCsCkdkVCyrN 30 +p CGE+Cv ++C +++GCsC+ VC+rN NBIL01132946.1 108 LPvCGETCVGGTC--YTPGCSCSWPVCTRN 135 577**********..*******988****9 PP >> NBIL01126374.1 Viola pubescens var. scabriuscula 5236409, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.2 11.7 1.7e-09 9.2e-06 1 30 [] 148 176 .. 148 176 .. 0.95 2 ! 30.7 11.9 2.4e-09 1.3e-05 1 30 [] 205 233 .. 205 233 .. 0.95 Alignments for each domain: == domain 1 score: 31.2 bits; conditional E-value: 1.7e-09 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GCsC+ VC+rN NBIL01126374.1 148 GLPvCGETCVGGTC--NTPGCSCSWPVCTRN 176 6899**********..*******988****9 PP == domain 2 score: 30.7 bits; conditional E-value: 2.4e-09 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GC+C+ VC+rN NBIL01126374.1 205 GLPvCGETCVGGTC--NTPGCTCSWPVCTRN 233 6899**********..*******988****9 PP >> NBIL01034143.1 Viola pubescens var. scabriuscula 5083416, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.8 10.0 1.6e-17 8.9e-14 2 30 .] 26 54 .. 24 54 .. 0.97 Alignments for each domain: == domain 1 score: 56.8 bits; conditional E-value: 1.6e-17 CCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVCyrN 30 +pCGEsCv+ipCita++GCsCk+kVCy+N NBIL01034143.1 26 VPCGESCVWIPCITAAIGCSCKSKVCYKN 54 79**************************9 PP >> NBIL01143694.1 Viola pubescens var. scabriuscula 5256500, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.1 9.3 2.6e-17 1.4e-13 1 30 [] 410 439 .. 410 439 .. 0.98 Alignments for each domain: == domain 1 score: 56.1 bits; conditional E-value: 2.6e-17 BCCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyrN 30 gipCGEsCv+ipC+++++GCsCk+kVCyrN NBIL01143694.1 410 GIPCGESCVWIPCFSSAFGCSCKSKVCYRN 439 7****************************9 PP >> NBIL01150594.1 Viola pubescens var. scabriuscula 5263593, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.5 11.8 1.7e-16 9.4e-13 3 30 .] 61 88 .. 58 88 .. 0.94 Alignments for each domain: == domain 1 score: 53.5 bits; conditional E-value: 1.7e-16 CCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCyrN 30 pCGEsCv+ipCit+v+GCsCk+kVCy+N NBIL01150594.1 61 PCGESCVFIPCITSVIGCSCKSKVCYKN 88 6**************************9 PP >> NBIL01061929.1 Viola pubescens var. scabriuscula 5129571, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 52.6 10.0 3.4e-16 1.8e-12 4 30 .] 1 27 [. 1 27 [. 0.99 Alignments for each domain: == domain 1 score: 52.6 bits; conditional E-value: 3.4e-16 CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVCyrN 30 CGEsCv+ipCita++GCsCk+kVCyrN NBIL01061929.1 1 CGESCVWIPCITAAIGCSCKSKVCYRN 27 **************************9 PP >> NBIL01116087.1 Viola pubescens var. scabriuscula 5219313, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.0 6.2 2.5e-16 1.3e-12 1 30 [] 91 120 .. 91 120 .. 0.98 Alignments for each domain: == domain 1 score: 53.0 bits; conditional E-value: 2.5e-16 BCCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyrN 30 gipCGEsCv+ip it ++GCsCk++VCyrN NBIL01116087.1 91 GIPCGESCVWIPRITGAIGCSCKSNVCYRN 120 8****************************9 PP >> NBIL01061928.1 Viola pubescens var. scabriuscula 5129570, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 52.0 10.0 5.1e-16 2.8e-12 4 30 .] 1 27 [. 1 27 [. 0.99 Alignments for each domain: == domain 1 score: 52.0 bits; conditional E-value: 5.1e-16 CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVCyrN 30 CGEsCv+ipCita++GCsCk+kVCyrN NBIL01061928.1 1 CGESCVWIPCITAAIGCSCKSKVCYRN 27 **************************9 PP >> NBIL01156090.1 Viola pubescens var. scabriuscula 5269105, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.3 7.8 8.7e-16 4.7e-12 2 30 .] 871 899 .. 869 899 .. 0.97 Alignments for each domain: == domain 1 score: 51.3 bits; conditional E-value: 8.7e-16 CCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVCyrN 30 +pCGEsCv+ipCi a++GCsCk+kVCyrN NBIL01156090.1 871 LPCGESCVWIPCIIAAIGCSCKSKVCYRN 899 79**************************9 PP >> NBIL01104711.1 Viola pubescens var. scabriuscula 5200522, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.4 10.9 8e-16 4.4e-12 3 30 .] 580 607 .. 577 607 .. 0.94 Alignments for each domain: == domain 1 score: 51.4 bits; conditional E-value: 8e-16 CCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCyrN 30 pCGEsCv+ipCi+av+GCsCk+kVCy+N NBIL01104711.1 580 PCGESCVFIPCISAVIGCSCKSKVCYKN 607 6**************************9 PP >> NBIL01038970.1 Viola pubescens var. scabriuscula 5091426, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 52.0 10.6 5.1e-16 2.8e-12 4 30 .] 1 27 [. 1 27 [. 0.99 Alignments for each domain: == domain 1 score: 52.0 bits; conditional E-value: 5.1e-16 CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVCyrN 30 CGEsCv+ipCita++GCsCk+kVCy+N NBIL01038970.1 1 CGESCVWIPCITAAIGCSCKSKVCYKN 27 **************************9 PP >> NBIL01008359.1 Viola pubescens var. scabriuscula 5012394, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.3 10.6 8.6e-16 4.7e-12 1 30 [] 26 55 .. 25 55 .. 0.96 Alignments for each domain: == domain 1 score: 51.3 bits; conditional E-value: 8.6e-16 BCCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyrN 30 ++pCGEsCv+ipCi++v+GCsCk+k+Cy N NBIL01008359.1 26 SVPCGESCVWIPCISSVVGCSCKSKICYMN 55 58**************************98 PP >> NBIL01116058.1 Viola pubescens var. scabriuscula 5219271, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.4 12.0 3.4e-10 1.8e-06 1 30 [] 238 266 .. 238 266 .. 0.95 2 ! 31.0 11.5 1.8e-09 9.9e-06 1 30 [] 292 320 .. 292 320 .. 0.95 3 ! 12.2 8.5 0.0014 7.7 3 29 .. 349 374 .. 346 375 .. 0.87 Alignments for each domain: == domain 1 score: 33.4 bits; conditional E-value: 3.4e-10 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+C+ ++C +++GCsC+ +C+rN NBIL01116058.1 238 GLPiCGETCFGGTC--NTPGCSCSYPICTRN 266 6899**********..*******999****9 PP == domain 2 score: 31.0 bits; conditional E-value: 1.8e-09 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GC C+ VC+rN NBIL01116058.1 292 GLPiCGETCVGGTC--NTPGCICSWPVCTRN 320 6899**********..*******988****9 PP == domain 3 score: 12.2 bits; conditional E-value: 0.0014 CCCE.E-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 3 pCGE.sCvyipCitavlGCsCkdkVCyr 29 +CG sCv + C ++GC C+ +C++ NBIL01116058.1 349 FCGDlSCVGGRC--PIPGCHCNWPICTK 374 48877*******..*******888**96 PP >> NBIL01131964.1 Viola pubescens var. scabriuscula 5244047, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.6 8.3 2.9e-15 1.6e-11 1 29 [. 193 221 .. 193 221 .. 0.98 Alignments for each domain: == domain 1 score: 49.6 bits; conditional E-value: 2.9e-15 BCCCCEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyr 29 gipCGEsCv+ipC+++++GC C++kVCyr NBIL01131964.1 193 GIPCGESCVWIPCFSSLIGCRCRSKVCYR 221 7***************************7 PP >> NBIL01054889.1 Viola pubescens var. scabriuscula 5117962, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.9 11.2 1.1e-15 6.1e-12 1 29 [. 2292 2320 .. 2292 2320 .. 0.97 Alignments for each domain: == domain 1 score: 50.9 bits; conditional E-value: 1.1e-15 BCCCCEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyr 29 +ipCGEsCv+ipC+t+v+GCsCk+kVCyr NBIL01054889.1 2292 SIPCGESCVWIPCFTSVIGCSCKSKVCYR 2320 69**************************7 PP >> NBIL01136227.1 Viola pubescens var. scabriuscula 5248576, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.6 8.3 2.9e-15 1.6e-11 1 29 [. 193 221 .. 193 221 .. 0.98 Alignments for each domain: == domain 1 score: 49.6 bits; conditional E-value: 2.9e-15 BCCCCEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyr 29 gipCGEsCv+ipC+++++GC C++kVCyr NBIL01136227.1 193 GIPCGESCVWIPCFSSLIGCRCRSKVCYR 221 7***************************7 PP >> NBIL01128065.1 Viola pubescens var. scabriuscula 5239218, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 8.9 1.0 0.015 84 19 30 .] 1 12 [. 1 12 [. 0.94 2 ! 33.9 11.8 2.3e-10 1.3e-06 1 30 [] 38 66 .. 38 66 .. 0.95 3 ! 18.6 9.4 1.5e-05 0.08 1 30 [] 92 120 .. 92 120 .. 0.93 == domain 2 score: 33.9 bits; conditional E-value: 2.3e-10 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GC+C+ VC+rN NBIL01128065.1 38 GLPiCGETCVGGTC--NTPGCTCSWPVCTRN 66 6899**********..*******988****9 PP == domain 3 score: 18.6 bits; conditional E-value: 1.5e-05 BCCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyrN 30 g+ C E+C ++C ta++ C+C+ C rN NBIL01128065.1 92 GLHCSETCLGGTC-TAAPVCTCNWPFCVRN 120 578**********.********88899998 PP >> NBIL01038971.1 Viola pubescens var. scabriuscula 5091427, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.1 10.6 2e-15 1.1e-11 4 30 .] 1 27 [. 1 27 [. 0.99 Alignments for each domain: == domain 1 score: 50.1 bits; conditional E-value: 2e-15 CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVCyrN 30 CGEsCv+ipCita++GCsCk+kVCy+N NBIL01038971.1 1 CGESCVWIPCITAAIGCSCKSKVCYKN 27 **************************9 PP >> NBIL01054676.1 Viola pubescens var. scabriuscula 5117610, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 8.3 2.4e-15 1.3e-11 1 29 [. 561 589 .. 561 589 .. 0.98 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 2.4e-15 BCCCCEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyr 29 gipCGEsCv+ipC+++++GC C++kVCyr NBIL01054676.1 561 GIPCGESCVWIPCFSSLIGCRCRSKVCYR 589 7***************************7 PP >> NBIL01134054.1 Viola pubescens var. scabriuscula 5246264, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.1 8.5 1.7e-14 9.5e-11 1 29 [. 1789 1817 .. 1789 1817 .. 0.98 Alignments for each domain: == domain 1 score: 47.1 bits; conditional E-value: 1.7e-14 BCCCCEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyr 29 gipCGEsCv+ipCi+ +GC C++kVCyr NBIL01134054.1 1789 GIPCGESCVWIPCISGHIGCRCRSKVCYR 1817 7***************************7 PP >> NBIL01131144.1 Viola pubescens var. scabriuscula 5243167, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.1 11.9 4.1e-10 2.2e-06 1 30 [] 2902 2930 .. 2902 2930 .. 0.95 2 ! 32.4 10.8 6.8e-10 3.7e-06 1 30 [] 2956 2984 .. 2956 2984 .. 0.93 Alignments for each domain: == domain 1 score: 33.1 bits; conditional E-value: 4.1e-10 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+C+ ++C +++GCsC+ VC+rN NBIL01131144.1 2902 GLPvCGETCFGGTC--YTPGCSCSYPVCTRN 2930 6899**********..*******999****9 PP == domain 2 score: 32.4 bits; conditional E-value: 6.8e-10 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+C+ ++C +++GCsC+ +C+rN NBIL01131144.1 2956 GLPiCGETCFGGTC--YTPGCSCSFPICMRN 2984 6899**********..*******866****9 PP >> NBIL01052473.1 Viola pubescens var. scabriuscula 5113967, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.0 11.4 3.3e-08 0.00018 1 30 [] 18 46 .. 17 46 .. 0.88 2 ! 27.0 11.4 3.3e-08 0.00018 1 30 [] 104 132 .. 103 132 .. 0.88 Alignments for each domain: == domain 1 score: 27.0 bits; conditional E-value: 3.3e-08 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 +i+ CGEsC++++C +++GCsC C +N NBIL01052473.1 18 SIFnCGESCILGTC--YTPGCSCVWGACSKN 46 5899**********..*******76677776 PP == domain 2 score: 27.0 bits; conditional E-value: 3.3e-08 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 +i+ CGEsC++++C +++GCsC C +N NBIL01052473.1 104 SIFnCGESCILGTC--YTPGCSCVWGACSKN 132 5899**********..*******76677776 PP >> NBIL01115411.1 Viola pubescens var. scabriuscula 5218185, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.9 10.9 2.4e-10 1.3e-06 1 30 [] 19 47 .. 19 47 .. 0.95 2 ! 18.3 7.9 1.7e-05 0.094 4 30 .] 77 101 .. 73 101 .. 0.82 Alignments for each domain: == domain 1 score: 33.9 bits; conditional E-value: 2.4e-10 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+C ++C +++GCsC+ VC+rN NBIL01115411.1 19 GLPiCGETCLGGTC--NTPGCSCSWPVCTRN 47 6899**********..*******988****9 PP == domain 2 score: 18.3 bits; conditional E-value: 1.7e-05 CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVCyrN 30 C+ +C+ ++C +++GC+C C rN NBIL01115411.1 77 CADTCMGGTC--HTPGCTCIWPSCVRN 101 **********..*******65566665 PP >> NBIL01121370.1 Viola pubescens var. scabriuscula 5228145, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.1 12.0 1.7e-14 9.4e-11 2 27 .. 177 202 .. 175 202 .. 0.97 Alignments for each domain: == domain 1 score: 47.1 bits; conditional E-value: 1.7e-14 CCCCEE-SSSS-SGGCCTEEEETTEE CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVC 27 +pCGEsCv+ipCita++GCsCk+kVC NBIL01121370.1 177 VPCGESCVWIPCITAAIGCSCKSKVC 202 79************************ PP >> NBIL01142031.1 Viola pubescens var. scabriuscula 5254746, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 45.3 12.8 6.5e-14 3.5e-10 1 28 [. 632 659 .. 632 660 .. 0.97 Alignments for each domain: == domain 1 score: 45.3 bits; conditional E-value: 6.5e-14 BCCCCEE-SSSS-SGGCCTEEEETTEEE CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCy 28 gipCGEsCv+ipC+t+++GCsC+++VCy NBIL01142031.1 632 GIPCGESCVFIPCFTSLIGCSCSSNVCY 659 7**************************9 PP >> NBIL01038909.1 Viola pubescens var. scabriuscula 5091330, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.8 10.5 8.9e-14 4.9e-10 2 30 .] 530 558 .. 528 558 .. 0.96 Alignments for each domain: == domain 1 score: 44.8 bits; conditional E-value: 8.9e-14 CCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVCyrN 30 ipCGEsCvy++C++a +GCsCk++VCy N NBIL01038909.1 530 IPCGESCVYMSCMSAFIGCSCKSRVCYIN 558 9**************************87 PP >> NBIL01098616.1 Viola pubescens var. scabriuscula 5190388, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 45.6 8.8 5e-14 2.7e-10 2 30 .] 429 458 .. 428 458 .. 0.96 Alignments for each domain: == domain 1 score: 45.6 bits; conditional E-value: 5e-14 CCCCEE-SSSS-.SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipC.itavlGCsCkdkVCyrN 30 ++CGEsCv++pC ++ ++GC+C++kVCy+N NBIL01098616.1 429 VSCGESCVWLPCgVSVLFGCKCNNKVCYKN 458 57***************************9 PP >> NBIL01098617.1 Viola pubescens var. scabriuscula 5190389, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.0 8.8 3.9e-14 2.1e-10 2 30 .] 289 318 .. 288 318 .. 0.96 Alignments for each domain: == domain 1 score: 46.0 bits; conditional E-value: 3.9e-14 CCCCEE-SSSS-.SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipC.itavlGCsCkdkVCyrN 30 ++CGEsCv++pC ++ ++GC+C++kVCy+N NBIL01098617.1 289 VSCGESCVWLPCgVSVLFGCKCNNKVCYKN 318 57***************************9 PP >> NBIL01094256.1 Viola pubescens var. scabriuscula 5183252, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 45.4 9.7 5.8e-14 3.2e-10 1 29 [. 572 600 .. 572 600 .. 0.98 Alignments for each domain: == domain 1 score: 45.4 bits; conditional E-value: 5.8e-14 BCCCCEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyr 29 gipCGEsCv+ipCi+ +GC C +kVCyr NBIL01094256.1 572 GIPCGESCVWIPCISGHIGCRCGSKVCYR 600 7***************************7 PP >> NBIL01130348.1 Viola pubescens var. scabriuscula 5242320, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 45.4 8.8 5.8e-14 3.2e-10 2 30 .] 289 318 .. 288 318 .. 0.96 Alignments for each domain: == domain 1 score: 45.4 bits; conditional E-value: 5.8e-14 CCCCEE-SSSS-.SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipC.itavlGCsCkdkVCyrN 30 ++CGEsCv++pC ++ ++GC+C++kVCy+N NBIL01130348.1 289 VSCGESCVWLPCgVSVLFGCKCNNKVCYKN 318 57***************************9 PP >> NBIL01148508.1 Viola pubescens var. scabriuscula 5261499, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 45.1 12.0 7.1e-14 3.9e-10 2 27 .. 251 276 .] 249 276 .] 0.97 Alignments for each domain: == domain 1 score: 45.1 bits; conditional E-value: 7.1e-14 CCCCEE-SSSS-SGGCCTEEEETTEE CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVC 27 +pCGEsCv+ipCi+av+GCsCk+kVC NBIL01148508.1 251 LPCGESCVFIPCISAVIGCSCKSKVC 276 79************************ PP >> NBIL01136957.1 Viola pubescens var. scabriuscula 5249352, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.7 11.6 1.1e-09 6.2e-06 2 30 .] 1809 1835 .. 1807 1835 .. 0.96 2 ! 27.9 12.1 1.7e-08 9.2e-05 2 29 .. 1863 1888 .. 1861 1889 .. 0.94 Alignments for each domain: == domain 1 score: 31.7 bits; conditional E-value: 1.1e-09 CCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVCyrN 30 ipCGE+C+ ++C +++GCsC VC+rN NBIL01136957.1 1809 IPCGETCFGGTC--YTPGCSCVWPVCTRN 1835 9***********..*******999****9 PP == domain 2 score: 27.9 bits; conditional E-value: 1.7e-08 CCCCEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVCyr 29 ipCGE+C+ ++C +++GC+C VC+r NBIL01136957.1 1863 IPCGETCFGGTC--YTPGCTCIWPVCTR 1888 9***********..*******988**98 PP >> NBIL01011626.1 Viola pubescens var. scabriuscula 5046085, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.8 8.7 1.2e-05 0.068 3 30 .] 79 104 .. 77 104 .. 0.94 2 ! 35.3 12.4 8.7e-11 4.8e-07 1 30 [] 133 161 .. 133 161 .. 0.95 Alignments for each domain: == domain 1 score: 18.8 bits; conditional E-value: 1.2e-05 CCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCyrN 30 +C E+C+ ++C ++ GC C C rN NBIL01011626.1 79 FCDETCFGGTC--NTHGCVCYWPMCQRN 104 7**********..*******988**998 PP == domain 2 score: 35.3 bits; conditional E-value: 8.7e-11 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GCsC+ VC+rN NBIL01011626.1 133 GVPiCGETCVGGTC--NTPGCSCSWPVCTRN 161 6899**********..*******988****9 PP >> NBIL01155155.1 Viola pubescens var. scabriuscula 5268167, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.2 8.1 2.4e-12 1.3e-08 1 30 [] 1106 1135 .. 1106 1135 .. 0.98 Alignments for each domain: == domain 1 score: 40.2 bits; conditional E-value: 2.4e-12 BCCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyrN 30 gi C+E+C + pC tav+GCsC++++Cy+N NBIL01155155.1 1106 GIHCAETCLWRPCRTAVIGCSCENNICYKN 1135 799**************************9 PP >> NBIL01019772.1 Viola pubescens var. scabriuscula 5059597, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.2 8.0 2.2e-11 1.2e-07 2 30 .] 852 881 .. 850 881 .. 0.95 Alignments for each domain: == domain 1 score: 37.2 bits; conditional E-value: 2.2e-11 CC.CCEE-SSSS-SGGCCTEEEETT..EEEET CS Cyclotide 2 ip.CGEsCvyipCitavlGCsCkdk..VCyrN 30 i+ CGE+C +++C +++GC C+ k VCy+N NBIL01019772.1 852 IFnCGETCLMGTC--YTPGCLCDQKwrVCYKN 881 788**********..********99******9 PP >> NBIL01110309.1 Viola pubescens var. scabriuscula 5209776, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.2 8.4 1.1e-11 5.9e-08 1 29 [. 545 574 .. 545 575 .. 0.95 Alignments for each domain: == domain 1 score: 38.2 bits; conditional E-value: 1.1e-11 BCCCCEE-SSSS-.SGGCCTEEEETTEEEE CS Cyclotide 1 gipCGEsCvyipC.itavlGCsCkdkVCyr 29 gi CGEsCvyipC +ta+l CsC++k C++ NBIL01110309.1 545 GIHCGESCVYIPCsFTALLRCSCNNKQCTN 574 799***********************9985 PP >> NBIL01059040.1 Viola pubescens var. scabriuscula 5124799, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.0 9.4 1.2e-11 6.5e-08 3 29 .. 62 89 .. 60 90 .. 0.93 Alignments for each domain: == domain 1 score: 38.0 bits; conditional E-value: 1.2e-11 CCCEE-SSSS-SGGCCTEEEETT.EEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdk.VCyr 29 +CGE+C++ipCit+++GCsC+ + VC + NBIL01059040.1 62 FCGETCILIPCITSLIGCSCNTRsVCWK 89 7*******************9889**65 PP >> NBIL01059041.1 Viola pubescens var. scabriuscula 5124800, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.0 9.4 1.2e-11 6.5e-08 3 29 .. 62 89 .. 60 90 .. 0.93 Alignments for each domain: == domain 1 score: 38.0 bits; conditional E-value: 1.2e-11 CCCEE-SSSS-SGGCCTEEEETT.EEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdk.VCyr 29 +CGE+C++ipCit+++GCsC+ + VC + NBIL01059041.1 62 FCGETCILIPCITSLIGCSCNTRsVCWK 89 7*******************9889**65 PP >> NBIL01059039.1 Viola pubescens var. scabriuscula 5124798, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.9 9.4 1.3e-11 7.3e-08 3 29 .. 148 175 .. 146 176 .. 0.93 Alignments for each domain: == domain 1 score: 37.9 bits; conditional E-value: 1.3e-11 CCCEE-SSSS-SGGCCTEEEETT.EEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdk.VCyr 29 +CGE+C++ipCit+++GCsC+ + VC + NBIL01059039.1 148 FCGETCILIPCITSLIGCSCNTRsVCWK 175 7*******************9889**65 PP >> NBIL01057213.1 Viola pubescens var. scabriuscula 5121795, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.3 8.9 4.2e-11 2.3e-07 1 30 [] 77 105 .. 77 105 .. 0.93 Alignments for each domain: == domain 1 score: 36.3 bits; conditional E-value: 4.2e-11 BCCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyrN 30 g++CGE+C+ ipC+t lGCsC+dk CyrN NBIL01057213.1 77 GVFCGETCAHIPCLTG-LGCSCTDKACYRN 105 79***********775.8***********9 PP >> NBIL01094901.1 Viola pubescens var. scabriuscula 5184331, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.5 11.7 7.4e-11 4e-07 1 30 [] 29 57 .. 29 57 .. 0.95 Alignments for each domain: == domain 1 score: 35.5 bits; conditional E-value: 7.4e-11 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GCsC+ VC+rN NBIL01094901.1 29 GLPvCGETCVGGTC--NTPGCSCSWPVCTRN 57 6899**********..*******988****9 PP >> NBIL01141280.1 Viola pubescens var. scabriuscula 5253954, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.5 12.7 1.5e-10 8.4e-07 3 29 .. 2049 2075 .. 2046 2076 .. 0.94 Alignments for each domain: == domain 1 score: 34.5 bits; conditional E-value: 1.5e-10 CCCEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCyr 29 pCGEsCvyi C+++++GCsC+ +VCy+ NBIL01141280.1 2049 PCGESCVYIGCVSSIVGCSCSGNVCYK 2075 7*************************7 PP >> NBIL01152762.1 Viola pubescens var. scabriuscula 5265767, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.4 11.7 7.7e-11 4.2e-07 1 30 [] 221 249 .. 221 249 .. 0.95 Alignments for each domain: == domain 1 score: 35.4 bits; conditional E-value: 7.7e-11 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GCsC+ VC+rN NBIL01152762.1 221 GLPvCGETCVGGTC--NTPGCSCSWPVCTRN 249 6899**********..*******988****9 PP >> NBIL01099996.1 Viola pubescens var. scabriuscula 5192667, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.8 5.9 1.2e-10 6.8e-07 1 30 [] 26 52 .. 26 52 .. 0.92 Alignments for each domain: == domain 1 score: 34.8 bits; conditional E-value: 1.2e-10 BCCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyrN 30 g pCGEsCv++ C + CsCk ++Cy+N NBIL01099996.1 26 GMPCGESCVWLQC---LSLCSCKKQLCYHN 52 68***********...667****99****9 PP >> NBIL01120810.1 Viola pubescens var. scabriuscula 5227246, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.6 11.7 1.3e-09 6.8e-06 1 30 [] 1565 1593 .. 1565 1593 .. 0.95 2 ! 20.7 9.8 3.2e-06 0.017 4 30 .] 1626 1652 .. 1623 1652 .. 0.90 Alignments for each domain: == domain 1 score: 31.6 bits; conditional E-value: 1.3e-09 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GCsC+ VC+rN NBIL01120810.1 1565 GLPvCGETCVGGTC--NTPGCSCSWPVCTRN 1593 6899**********..*******988****9 PP == domain 2 score: 20.7 bits; conditional E-value: 3.2e-06 C.CEE-SSSS-SGGCCTEEEETT.EEEET CS Cyclotide 4 C.GEsCvyipCitavlGCsCkdk.VCyrN 30 C GE+C++++C ++ GC Ck+ +C+rN NBIL01120810.1 1626 CgGETCFTGKC--NAKGCDCKNWpLCTRN 1652 537********..********99*****9 PP >> NBIL01106296.1 Viola pubescens var. scabriuscula 5203118, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.1 5.9 2.1e-10 1.1e-06 1 30 [] 26 52 .. 26 52 .. 0.92 Alignments for each domain: == domain 1 score: 34.1 bits; conditional E-value: 2.1e-10 BCCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyrN 30 g pCGEsCv++ C + CsCk ++Cy+N NBIL01106296.1 26 GMPCGESCVWLQC---LSLCSCKKQLCYHN 52 68***********...667****99****9 PP >> NBIL01090773.1 Viola pubescens var. scabriuscula 5177551, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.8 13.2 5e-10 2.8e-06 1 27 [. 3599 3625 .. 3598 3626 .. 0.95 Alignments for each domain: == domain 1 score: 32.8 bits; conditional E-value: 5e-10 BCCCCEE-SSSS-SGGCCTEEEETTEE CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVC 27 ++pCG sCv+i+Ci+av+GCsCk+kVC NBIL01090773.1 3599 SVPCGGSCVFITCISAVVGCSCKSKVC 3625 58************************* PP >> NBIL01103596.1 Viola pubescens var. scabriuscula 5198678, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.3 5.8 8.8e-11 4.8e-07 5 30 .] 150 174 .. 150 174 .. 0.94 Alignments for each domain: == domain 1 score: 35.3 bits; conditional E-value: 8.8e-11 CEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 5 GEsCvyipCitavlGCsCkdkVCyrN 30 GE+C+yipC+t lGCsCkdk CyrN NBIL01103596.1 150 GETCAYIPCLTG-LGCSCKDKACYRN 174 9********775.8***********9 PP >> NBIL01138940.1 Viola pubescens var. scabriuscula 5251468, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.2 8.7 3.8e-10 2.1e-06 3 29 .. 776 802 .. 773 803 .. 0.94 Alignments for each domain: == domain 1 score: 33.2 bits; conditional E-value: 3.8e-10 CCCEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCyr 29 CGE+C++ pC ta++GC C+ k+Cy+ NBIL01138940.1 776 HCGETCAINPCATAAIGCYCSKKICYK 802 5********************99***7 PP >> NBIL01133828.1 Viola pubescens var. scabriuscula 5246027, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 12.6 2.1 0.0011 6 1 30 [] 305 333 .. 305 333 .. 0.94 2 ! 26.3 13.5 5.5e-08 0.0003 1 28 [. 360 386 .. 360 393 .. 0.84 Alignments for each domain: == domain 1 score: 12.6 bits; conditional E-value: 0.0011 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p C E+Cv ++ +G sC+ +C rN NBIL01133828.1 305 GLPiCVETCVAGTY--GSPGRSCNWPICARN 333 6899**********..*******888***99 PP == domain 2 score: 26.3 bits; conditional E-value: 5.5e-08 BCC.CCEE-SSSS-SGGCCTEEEETTEEE CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCy 28 g+p CGE+Cv ++C +++GCsC+ VC+ NBIL01133828.1 360 GLPiCGETCVGGTC--NTPGCSCSWPVCT 386 6899**********..*******877665 PP >> NBIL01125957.1 Viola pubescens var. scabriuscula 5235684, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.4 10.0 5.8e-09 3.2e-05 2 30 .] 172 199 .. 170 199 .. 0.92 2 ! 16.3 7.1 7.5e-05 0.41 3 30 .] 227 254 .. 225 254 .. 0.92 Alignments for each domain: == domain 1 score: 29.4 bits; conditional E-value: 5.8e-09 CCCCEE-SSSS-SGGCCTEEEETT.EEEET CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdk.VCyrN 30 +pCGE+C +pC +GC+C+ + VC rN NBIL01125957.1 172 TPCGETCHNFPC--RSPGCTCNREsVCVRN 199 79**********..*******8669***99 PP == domain 2 score: 16.3 bits; conditional E-value: 7.5e-05 CCCEE-SSSS-SGGCCTEEEETT..EEEET CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdk..VCyrN 30 +CGE C + C ++GC+C + VC rN NBIL01125957.1 227 SCGERCPQGWC--RTVGCTCYLHdlVCVRN 254 6**********..*******87788**999 PP >> NBIL01123507.1 Viola pubescens var. scabriuscula 5231667, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.3 12.0 3.5e-10 1.9e-06 1 30 [] 259 287 .. 259 287 .. 0.95 Alignments for each domain: == domain 1 score: 33.3 bits; conditional E-value: 3.5e-10 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GC+C+ VC+rN NBIL01123507.1 259 GLPvCGETCVGGTC--NTPGCTCTWPVCTRN 287 6899**********..*******999****9 PP >> NBIL01140378.1 Viola pubescens var. scabriuscula 5252998, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.2 10.9 8.1e-10 4.4e-06 1 30 [] 586 614 .. 586 614 .. 0.93 Alignments for each domain: == domain 1 score: 32.2 bits; conditional E-value: 8.1e-10 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+C+ + C +++GCsC+ VC+rN NBIL01140378.1 586 GLPiCGETCFGGRC--NTPGCSCSFPVCTRN 614 6899**********..*******866****9 PP >> NBIL01061753.1 Viola pubescens var. scabriuscula 5129291, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.6 11.1 1.2e-09 6.8e-06 1 30 [] 456 484 .. 456 484 .. 0.95 Alignments for each domain: == domain 1 score: 31.6 bits; conditional E-value: 1.2e-09 BCC.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyrN 30 g+p CGE+Cv ++C +++GCsC+ C+rN NBIL01061753.1 456 GLPvCGETCVGGTC--NTPGCSCSWPMCTRN 484 6899**********..*******988****9 PP >> NBIL01073220.1 Viola pubescens var. scabriuscula 5148240, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.2 8.0 8.2e-10 4.5e-06 3 30 .] 124 149 .. 121 149 .. 0.95 Alignments for each domain: == domain 1 score: 32.2 bits; conditional E-value: 8.2e-10 CCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCyrN 30 pCGE+C ++pC + +GCsC+ +C rN NBIL01073220.1 124 PCGETCELLPC--YNPGCSCRFFLCVRN 149 7**********..*******988***99 PP >> NBIL01087216.1 Viola pubescens var. scabriuscula 5171569, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.0 6.2 1.9e-09 1e-05 4 30 .] 447 473 .. 443 473 .. 0.95 Alignments for each domain: == domain 1 score: 31.0 bits; conditional E-value: 1.9e-09 CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVCyrN 30 C+EsC++ pCit+vlGC C+ ++C +N NBIL01087216.1 447 CAESCAVKPCITSVLGCLCRRTICRLN 473 ********************99**988 PP >> NBIL01054660.1 Viola pubescens var. scabriuscula 5117580, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.6 9.3 5.2e-09 2.8e-05 3 29 .. 30 57 .. 28 58 .. 0.95 Alignments for each domain: == domain 1 score: 29.6 bits; conditional E-value: 5.2e-09 CCCEE-SSSS-.SGGCCTEEEETTEEEE CS Cyclotide 3 pCGEsCvyipC.itavlGCsCkdkVCyr 29 pCGE+C y +C +tav+GCsC d Cy+ NBIL01054660.1 30 PCGETCHYTSCfLTAVFGCSCLDGYCYN 57 8*********************999994 PP >> NBIL01080207.1 Viola pubescens var. scabriuscula 5159920, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.6 9.4 1e-08 5.6e-05 3 30 .] 79 106 .. 77 106 .. 0.91 Alignments for each domain: == domain 1 score: 28.6 bits; conditional E-value: 1e-08 C.CCEE-SSSS.-SGGCCTEEEETTEEEET CS Cyclotide 3 p.CGEsCvyip.CitavlGCsCkdkVCyrN 30 + CGE+C++ip C + +GC C+ +C+rN NBIL01080207.1 79 StCGETCFIIPrC--HNPGCVCTRGICTRN 106 55***********..*******988****9 PP >> NBIL01044746.1 Viola pubescens var. scabriuscula 5101041, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.4 8.1 6.1e-09 3.3e-05 2 30 .] 107 135 .. 104 135 .. 0.94 Alignments for each domain: == domain 1 score: 29.4 bits; conditional E-value: 6.1e-09 CCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVCyrN 30 i CGE+C+ + C++ + GC Ck+ C +N NBIL01044746.1 107 IYCGETCRGGFCFSMIYGCQCKNDFCIKN 135 66************************998 PP >> NBIL01157479.1 Viola pubescens var. scabriuscula 5270498, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.3 12.0 3e-09 1.7e-05 3 30 .] 462 488 .. 460 488 .. 0.93 Alignments for each domain: == domain 1 score: 30.3 bits; conditional E-value: 3e-09 C.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 3 p.CGEsCvyipCitavlGCsCkdkVCyrN 30 p CGE+C++ +C +++GC+C+ VC++N NBIL01157479.1 462 PvCGETCFTSKC--NTPGCTCSYAVCTLN 488 77**********..*******999***98 PP >> NBIL01063013.1 Viola pubescens var. scabriuscula 5131420, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.5 7.9 5.4e-09 2.9e-05 3 30 .] 1155 1183 .. 1153 1183 .. 0.90 Alignments for each domain: == domain 1 score: 29.5 bits; conditional E-value: 5.4e-09 C.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 3 p.CGEsCvyipCitavlGCsCkdkVCyrN 30 C E+C++ pC t+vlGC+C+++ C N NBIL01063013.1 1155 LdCSETCRWTPCATSVLGCTCRNNACSWN 1183 44************************866 PP >> NBIL01145351.1 Viola pubescens var. scabriuscula 5258251, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.1 5.9 1.5e-08 8.3e-05 4 29 .. 95 120 .. 93 120 .. 0.95 Alignments for each domain: == domain 1 score: 28.1 bits; conditional E-value: 1.5e-08 CCEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVCyr 29 C E+Cv++pC++ +lGC C d++C++ NBIL01145351.1 95 CWETCVFFPCLSQLLGCVCFDRICTH 120 99**********************95 PP >> NBIL01133828.1 Viola pubescens var. scabriuscula 5246027, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.3 11.4 6.2e-09 3.4e-05 1 29 [. 252 279 .. 252 280 .. 0.93 Alignments for each domain: == domain 1 score: 29.3 bits; conditional E-value: 6.2e-09 BCC.CCEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkdkVCyr 29 g+p CGE+Cv ++C +++GCsC+ VC+r NBIL01133828.1 252 GLPiCGETCVGGTC--NTPGCSCSWPVCTR 279 6899**********..*******988**97 PP >> NBIL01052580.1 Viola pubescens var. scabriuscula 5114150, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.8 10.9 9e-09 4.9e-05 3 30 .] 1558 1583 .. 1555 1583 .. 0.93 Alignments for each domain: == domain 1 score: 28.8 bits; conditional E-value: 9e-09 CCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCyrN 30 CGEsC+ + C +++GC+C+ +C++N NBIL01052580.1 1558 NCGESCFQGEC--YTPGCTCSYPLCTKN 1583 5**********..*******989***99 PP >> NBIL01109779.1 Viola pubescens var. scabriuscula 5208938, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.4 4.7 1.2e-08 6.4e-05 1 29 [. 1243 1271 .. 1243 1272 .. 0.92 Alignments for each domain: == domain 1 score: 28.4 bits; conditional E-value: 1.2e-08 BCCCCEE-SSSS-SGGCCTEEEETT..EEEE CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdk..VCyr 29 gipCGE+Cv++ C + + C C+ + +C++ NBIL01109779.1 1243 GIPCGETCVWFRC--FDPACHCDPRsrLCMN 1271 7************..*******97788**85 PP >> NBIL01080891.1 Viola pubescens var. scabriuscula 5161033, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.9 6.2 1.8e-08 9.8e-05 4 29 .. 95 120 .. 92 121 .. 0.94 Alignments for each domain: == domain 1 score: 27.9 bits; conditional E-value: 1.8e-08 CCEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVCyr 29 C E+Cv++pC++ + GC C d++C++ NBIL01080891.1 95 CWETCVFFPCLSQLYGCLCLDRICTH 120 99**********************96 PP >> NBIL01037573.1 Viola pubescens var. scabriuscula 5089096, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.0 9.0 1.6e-08 8.9e-05 2 30 .] 26 53 .. 23 53 .. 0.92 Alignments for each domain: == domain 1 score: 28.0 bits; conditional E-value: 1.6e-08 CCCCEE-SSSS-SGGCCTEEEETT.EEEET CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdk.VCyrN 30 ipCGE+C +pC +GC+C+ + C rN NBIL01037573.1 26 IPCGETCHNFPC--RSPGCTCNREfFCVRN 53 9***********..*******866999998 PP >> NBIL01079806.1 Viola pubescens var. scabriuscula 5159236, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.7 7.0 2.1e-08 0.00011 3 28 .. 509 537 .. 507 538 .. 0.93 Alignments for each domain: == domain 1 score: 27.7 bits; conditional E-value: 2.1e-08 CCCEE-SSSS-SGGCCT..EEEETT.EEE CS Cyclotide 3 pCGEsCvyipCitavlG..CsCkdk.VCy 28 CGE+C+++pC +vlG C Ck+ +Cy NBIL01079806.1 509 ICGETCRWGPCTASVLGvrCLCKNAdLCY 537 4**********99***********9***9 PP >> NBIL01137567.1 Viola pubescens var. scabriuscula 5250016, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.4 5.5 5e-08 0.00027 3 29 .. 144 170 .. 142 171 .. 0.93 Alignments for each domain: == domain 1 score: 26.4 bits; conditional E-value: 5e-08 CCCEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCyr 29 +C E+C+++pC++ GC C + +C++ NBIL01137567.1 144 QCYETCFWFPCFSGFYGCICANPLCKL 170 599**********************97 PP >> NBIL01102588.1 Viola pubescens var. scabriuscula 5197008, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.5 6.8 9.7e-08 0.00053 2 23 .. 155 174 .. 153 178 .. 0.92 Alignments for each domain: == domain 1 score: 25.5 bits; conditional E-value: 9.7e-08 CCCCEE-SSSS-SGGCCTEEEE CS Cyclotide 2 ipCGEsCvyipCitavlGCsCk 23 ipCGE+C +pC +GC+C+ NBIL01102588.1 155 IPCGETCHNFPC--RSPGCTCN 174 9***********..*******6 PP >> NBIL01062985.1 Viola pubescens var. scabriuscula 5131374, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.9 6.9 7.4e-08 0.00041 5 28 .. 84 106 .. 81 108 .. 0.93 Alignments for each domain: == domain 1 score: 25.9 bits; conditional E-value: 7.4e-08 CEE-SSSS-SGGCCTEEEETT.EEE CS Cyclotide 5 GEsCvyipCitavlGCsCkdk.VCy 28 GEsC++++C +++GCsC + +Cy NBIL01062985.1 84 GESCMLGKC--YTAGCSCGSWkLCY 106 9********..*******9867**9 PP >> NBIL01144957.1 Viola pubescens var. scabriuscula 5257837, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.1 10.5 1.3e-07 0.00073 1 23 [. 121 142 .. 121 150 .. 0.91 Alignments for each domain: == domain 1 score: 25.1 bits; conditional E-value: 1.3e-07 BCC.CCEE-SSSS-SGGCCTEEEE CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCk 23 g+p CGE+Cv ++C +++GCsC+ NBIL01144957.1 121 GLPvCGETCVGGTC--NTPGCSCS 142 6899**********..*******6 PP >> NBIL01039848.1 Viola pubescens var. scabriuscula 5092868, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.5 5.3 1e-07 0.00055 3 30 .] 109 142 .. 107 142 .. 0.79 Alignments for each domain: == domain 1 score: 25.5 bits; conditional E-value: 1e-07 CCCEE-SSSS-SGGCCTEEEETT......EEEET CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdk......VCyrN 30 CGEsC pC+t + GC Ck Cy N NBIL01039848.1 109 HCGESCLGRPCFTVMQGCLCKFDqetkikFCYMN 142 6*******************83345666667665 PP >> NBIL01122314.1 Viola pubescens var. scabriuscula 5229672, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.2 9.2 5.8e-08 0.00032 4 30 .] 112 136 .. 110 136 .. 0.96 Alignments for each domain: == domain 1 score: 26.2 bits; conditional E-value: 5.8e-08 CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVCyrN 30 C E+C +pC ++ GCsCk++ Cy+N NBIL01122314.1 112 CRETCYHLPC--YTWGCSCKNHGCYKN 136 99********..**************9 PP >> NBIL01102402.1 Viola pubescens var. scabriuscula 5196674, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 24.8 9.6 1.6e-07 0.00089 4 30 .] 33 60 .. 31 60 .. 0.93 Alignments for each domain: == domain 1 score: 24.8 bits; conditional E-value: 1.6e-07 CCEE-SSSS-SGGCCTEEEETT.EEEET CS Cyclotide 4 CGEsCvyipCitavlGCsCkdk.VCyrN 30 CGE+C yi C+t + GC Ck+ Cy N NBIL01102402.1 33 CGETCKYIGCFTILQGCLCKEDnKCYTN 60 *******************977899988 PP >> NBIL01072490.1 Viola pubescens var. scabriuscula 5147010, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.1 14.6 6.5e-08 0.00036 2 30 .] 248 276 .. 246 276 .. 0.91 Alignments for each domain: == domain 1 score: 26.1 bits; conditional E-value: 6.5e-08 CCCCEE-SS.SS-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvy.ipCitavlGCsCkdkVCyrN 30 +pCGEsC + ipC+t+++GCsC++kVCy N NBIL01072490.1 248 VPCGESC-V*IPCLTSIAGCSCSNKVCYIN 276 79*****.666*****************87 PP >> NBIL01043142.1 Viola pubescens var. scabriuscula 5098314, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.0 9.2 6.8e-08 0.00037 3 30 .] 829 854 .. 827 854 .. 0.98 Alignments for each domain: == domain 1 score: 26.0 bits; conditional E-value: 6.8e-08 CCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCyrN 30 pCGE+C ++ C + GC C +++CyrN NBIL01043142.1 829 PCGETCKILAC--NYYGCQCYARICYRN 854 8**********..**************9 PP >> NBIL01099581.1 Viola pubescens var. scabriuscula 5191962, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.8 3.8 7.8e-08 0.00042 5 28 .. 1 27 [. 1 28 [. 0.97 Alignments for each domain: == domain 1 score: 25.8 bits; conditional E-value: 7.8e-08 CEE-SSSS-SGGCCT..EEEETT.EEE CS Cyclotide 5 GEsCvyipCitavlG..CsCkdk.VCy 28 GE+C+++pC +vlG C Ck+ +Cy NBIL01099581.1 1 GETCRWGPCTASVLGvrCLCKNAdLCY 27 9********99***********9***9 PP >> NBIL01014972.1 Viola pubescens var. scabriuscula 5051637, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 24.1 8.3 2.6e-07 0.0014 2 30 .] 30 58 .. 28 58 .. 0.91 Alignments for each domain: == domain 1 score: 24.1 bits; conditional E-value: 2.6e-07 CCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVCyrN 30 + C E+C y+ C++a++GCsC+d C +N NBIL01014972.1 30 VRCVETCYYLGCLSAMFGCSCNDGKCVNN 58 56********************9888876 PP >> NBIL01140086.1 Viola pubescens var. scabriuscula 5252677, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 24.0 5.0 2.9e-07 0.0016 5 29 .. 3069 3091 .. 3064 3092 .. 0.91 Alignments for each domain: == domain 1 score: 24.0 bits; conditional E-value: 2.9e-07 CEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 5 GEsCvyipCitavlGCsCkdkVCyr 29 GEsC++++C ++ GCsC+ +C+r NBIL01140086.1 3069 GESCFTGTC--YTRGCSCDWPICKR 3091 9********..*******988**97 PP >> NBIL01010979.1 Viola pubescens var. scabriuscula 5044991, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.5 5.6 9.5e-08 0.00052 13 30 .] 1 18 [. 1 18 [. 0.99 2 ? 1.8 2.0 2.5 1.4e+04 11 23 .. 62 74 .. 61 79 .. 0.85 == domain 2 score: 1.8 bits; conditional E-value: 2.5 SS-SGGCCTEEEE CS Cyclotide 11 ipCitavlGCsCk 23 i+C+ ++ C C+ NBIL01010979.1 62 IKCLEHIYTCMCQ 74 89**********6 PP >> NBIL01082668.1 Viola pubescens var. scabriuscula 5164011, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.9 7.9 3.2e-07 0.0017 3 28 .. 780 805 .. 777 807 .. 0.90 Alignments for each domain: == domain 1 score: 23.9 bits; conditional E-value: 3.2e-07 CCCEE-SSSS-SGGCCTEEEETTEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCy 28 CGE Cv++pC++ + GC C+ +C NBIL01082668.1 780 ICGEICVFFPCVSQLYGCECRKIICE 805 5*******************966**7 PP >> NBIL01116941.1 Viola pubescens var. scabriuscula 5220711, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.8 8.5 6.7e-07 0.0037 3 29 .. 4576 4604 .. 4574 4604 .. 0.94 Alignments for each domain: == domain 1 score: 22.8 bits; conditional E-value: 6.7e-07 CCCEE-SSSS-SGGCCTEEEETT..EEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdk..VCyr 29 +C E+C++ipC++ + GC C++k VC r NBIL01116941.1 4576 FCLETCMTIPCYSRAGGCGCNNKwgVCVR 4604 799************************75 PP >> NBIL01134343.1 Viola pubescens var. scabriuscula 5246572, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 24.7 11.0 1.7e-07 0.00093 1 30 [] 55 88 .. 55 88 .. 0.94 Alignments for each domain: == domain 1 score: 24.7 bits; conditional E-value: 1.7e-07 BCCCCEE-SSSS-SGGCCTEEEETT....EEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdk....VCyrN 30 g++CGE+C ++pC+++ GC C+ VC +N NBIL01134343.1 55 GVFCGETCSVVPCFSSSRGCGCTYMgggmVCVKN 88 79********************977999999998 PP >> NBIL01110244.1 Viola pubescens var. scabriuscula 5209677, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.5 7.4 4.2e-07 0.0023 2 28 .. 98 124 .. 97 126 .. 0.94 Alignments for each domain: == domain 1 score: 23.5 bits; conditional E-value: 4.2e-07 CCCCEE-SSSS-SGGCCTEEEETTEEE CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVCy 28 ipC E+C++i Ci+ GC C+ + C NBIL01110244.1 98 IPCFETCFLIGCISGFYGCICDGRFCL 124 9*********************99996 PP >> NBIL01077605.1 Viola pubescens var. scabriuscula 5155591, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 24.6 3.8 1.9e-07 0.001 5 28 .. 1 27 [. 1 28 [. 0.97 Alignments for each domain: == domain 1 score: 24.6 bits; conditional E-value: 1.9e-07 CEE-SSSS-SGGCCT..EEEETT.EEE CS Cyclotide 5 GEsCvyipCitavlG..CsCkdk.VCy 28 GE+C+++pC +vlG C Ck+ +Cy NBIL01077605.1 1 GETCRWGPCTASVLGvrCLCKNAdLCY 27 9********99***********9***9 PP >> NBIL01114253.1 Viola pubescens var. scabriuscula 5216284, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.1 8.6 5.4e-07 0.0029 4 26 .. 353 374 .. 350 378 .. 0.87 Alignments for each domain: == domain 1 score: 23.1 bits; conditional E-value: 5.4e-07 CCEE-SSSS-SGGCCTEEEETTE CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkV 26 C E+C+++pCit v+GC C+ +V NBIL01114253.1 353 CYETCFFFPCITQVFGCVCD-RV 374 99*****************6.54 PP >> NBIL01114252.1 Viola pubescens var. scabriuscula 5216283, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.6 8.6 3.9e-07 0.0022 4 26 .. 86 107 .. 83 111 .. 0.87 Alignments for each domain: == domain 1 score: 23.6 bits; conditional E-value: 3.9e-07 CCEE-SSSS-SGGCCTEEEETTE CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkV 26 C E+C+++pCit v+GC C+ +V NBIL01114252.1 86 CYETCFFFPCITQVFGCVCD-RV 107 99*****************6.54 PP >> NBIL01114251.1 Viola pubescens var. scabriuscula 5216282, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.2 8.6 5.3e-07 0.0029 4 26 .. 86 107 .. 83 111 .. 0.87 Alignments for each domain: == domain 1 score: 23.2 bits; conditional E-value: 5.3e-07 CCEE-SSSS-SGGCCTEEEETTE CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkV 26 C E+C+++pCit v+GC C+ +V NBIL01114251.1 86 CYETCFFFPCITQVFGCVCD-RV 107 99*****************6.54 PP >> NBIL01140087.1 Viola pubescens var. scabriuscula 5252678, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 24.0 5.0 2.9e-07 0.0016 5 29 .. 3077 3099 .. 3072 3100 .. 0.91 Alignments for each domain: == domain 1 score: 24.0 bits; conditional E-value: 2.9e-07 CEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 5 GEsCvyipCitavlGCsCkdkVCyr 29 GEsC++++C ++ GCsC+ +C+r NBIL01140087.1 3077 GESCFTGTC--YTRGCSCDWPICKR 3099 9********..*******988**97 PP >> NBIL01063447.1 Viola pubescens var. scabriuscula 5132114, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.7 10.1 3.6e-07 0.0019 3 30 .] 1397 1423 .. 1393 1423 .. 0.90 Alignments for each domain: == domain 1 score: 23.7 bits; conditional E-value: 3.6e-07 CCCEE-SSSS-SGGCCTEEEETT.EEEET CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdk.VCyrN 30 CGE+C + +C ++ GCsC + VC++N NBIL01063447.1 1397 NCGETCLMDTC--YTSGCSCGAYrVCTKN 1423 4**********..*******9879***99 PP >> NBIL01082528.1 Viola pubescens var. scabriuscula 5163767, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.0 4.7 1.2e-06 0.0066 3 30 .] 792 819 .. 790 819 .. 0.92 Alignments for each domain: == domain 1 score: 22.0 bits; conditional E-value: 1.2e-06 CCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCyrN 30 +C E+C+++pC++ +l C C+ +C r+ NBIL01082528.1 792 QCYETCIFFPCLSQLLKCYCSQIICIRD 819 599*****************977**885 PP >> NBIL01055430.1 Viola pubescens var. scabriuscula 5118876, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.1 5.6 5.5e-07 0.003 4 29 .. 413 438 .. 411 439 .. 0.92 Alignments for each domain: == domain 1 score: 23.1 bits; conditional E-value: 5.5e-07 CCEE-SSSS-SGGCCTEEEETTEEEE CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVCyr 29 C E+C+++pC++ +l C C+ +C r NBIL01055430.1 413 CWETCFFFPCMSQLLKCYCNQVLCIR 438 99*****************877**76 PP >> NBIL01029191.1 Viola pubescens var. scabriuscula 5075144, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.1 7.9 1.1e-06 0.0062 3 27 .. 150 174 .. 147 176 .. 0.89 Alignments for each domain: == domain 1 score: 22.1 bits; conditional E-value: 1.1e-06 CCCEE-SSSS-SGGCCTEEEETTEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVC 27 C EsC+++pC++ + GC C +C NBIL01029191.1 150 NCLESCFFFPCVSQLYGCECIKVIC 174 599*****************86699 PP >> NBIL01139840.1 Viola pubescens var. scabriuscula 5252416, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.6 7.1 3.4e-06 0.018 3 28 .. 321 346 .. 319 348 .. 0.90 Alignments for each domain: == domain 1 score: 20.6 bits; conditional E-value: 3.4e-06 CCCEE-SSSS-SGGCCTEEEETTEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCy 28 +C E+C+++pC++ ++GC C +C+ NBIL01139840.1 321 SCRETCIFFPCLSQLIGCQCIKIICT 346 59******************866**8 PP >> NBIL01136299.1 Viola pubescens var. scabriuscula 5248651, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.8 8.9 1.4e-06 0.0079 3 28 .. 175 200 .. 173 201 .. 0.91 Alignments for each domain: == domain 1 score: 21.8 bits; conditional E-value: 1.4e-06 C.CCEE-SSSS-SGGCCTE.EEETTEEE CS Cyclotide 3 p.CGEsCvyipCitavlGC.sCkdkVCy 28 p CGE+C+++pC +v GC +C++ +Cy NBIL01136299.1 175 PhCGETCMVLPC--FVSGCyKCRAPICY 200 55**********..*****66**99**9 PP >> NBIL01029192.1 Viola pubescens var. scabriuscula 5075145, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.9 9.6 2.6e-06 0.014 3 27 .. 150 174 .. 148 176 .. 0.89 Alignments for each domain: == domain 1 score: 20.9 bits; conditional E-value: 2.6e-06 CCCEE-SSSS-SGGCCTEEEETTEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVC 27 C E+C+++pC++ + GC C +C NBIL01029192.1 150 DCVETCFFFPCVSQLYGCECIKVIC 174 5*******************86699 PP >> NBIL01056946.1 Viola pubescens var. scabriuscula 5121375, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.9 9.2 1.3e-06 0.0071 3 28 .. 99 124 .. 97 126 .. 0.89 2 ? 2.7 2.7 1.3 7e+03 14 29 .. 137 152 .. 134 153 .. 0.86 Alignments for each domain: == domain 1 score: 21.9 bits; conditional E-value: 1.3e-06 CCCEE-SSSS-SGGCCTEEEETTEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCy 28 pC E+C+++ Ci+ v+GC C+ +C NBIL01056946.1 99 PCFETCFVFNCISGVFGCICDFGICL 124 8*******************755995 PP == domain 2 score: 2.7 bits; conditional E-value: 1.3 SGGCCTEEEETTEEEE CS Cyclotide 14 itavlGCsCkdkVCyr 29 i+ +l C C+ k+C++ NBIL01056946.1 137 ISILLHCCCSFKICKK 152 577899***999**96 PP >> NBIL01077077.1 Viola pubescens var. scabriuscula 5154634, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.0 10.7 2.6e-06 0.014 1 23 [. 769 791 .. 769 802 .. 0.87 Alignments for each domain: == domain 1 score: 21.0 bits; conditional E-value: 2.6e-06 BCCCCEE-SSSS-SGGCCTEEEE CS Cyclotide 1 gipCGEsCvyipCitavlGCsCk 23 gi+CGE+C ++pC+++ GC C+ NBIL01077077.1 769 GIFCGETCSVFPCFSSSRGCGCT 791 7*********************7 PP >> NBIL01058313.1 Viola pubescens var. scabriuscula 5123611, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.7 6.4 3.1e-06 0.017 4 27 .. 1 24 [. 1 26 [. 0.92 Alignments for each domain: == domain 1 score: 20.7 bits; conditional E-value: 3.1e-06 CCEE-SSSS-SGGCCTEEEETTEE CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVC 27 C E+C+++pC++ +l C C+ +C NBIL01058313.1 1 CWETCFFFPCMSQLLKCYCNQVLC 24 88*****************87799 PP >> NBIL01149629.1 Viola pubescens var. scabriuscula 5262625, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 21.1 7.7 2.3e-06 0.013 1 24 [. 560 582 .. 560 588 .. 0.85 2 ? 12.9 7.8 0.00088 4.8 3 30 .] 637 663 .. 635 663 .. 0.90 3 ? 0.5 0.3 6.4 3.5e+04 17 28 .. 686 697 .. 681 699 .. 0.77 Alignments for each domain: == domain 1 score: 21.1 bits; conditional E-value: 2.3e-06 BCC.CCEE-SSSS-SGGCCTEEEET CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCkd 24 g+p C E+Cv ++C +++GCsC+ NBIL01149629.1 560 GLPiCEETCVGGTC--NTPGCSCSW 582 6899**********..*******75 PP == domain 2 score: 12.9 bits; conditional E-value: 0.00088 C.CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 3 p.CGEsCvyipCitavlGCsCkdkVCyrN 30 C sC+ + C + lGC+C +C rN NBIL01149629.1 637 AvCSGSCIDGHC--YFLGCTCHWPICIRN 663 55999*******..*******988**999 PP == domain 3 score: 0.5 bits; conditional E-value: 6.4 CCTEEEETTEEE CS Cyclotide 17 vlGCsCkdkVCy 28 + CsC+ +C NBIL01149629.1 686 SFSCSCSLPLCW 697 567***888996 PP >> NBIL01032974.1 Viola pubescens var. scabriuscula 5081437, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 20.9 5.8 2.7e-06 0.015 4 27 .. 772 795 .. 770 796 .] 0.92 Alignments for each domain: == domain 1 score: 20.9 bits; conditional E-value: 2.7e-06 CCEE-SSSS-SGGCCTEEEETTEE CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVC 27 C E+C+++pC++ +l C C+ +C NBIL01032974.1 772 CWETCFFFPCMSQLLKCYCNQVLC 795 99*****************87799 PP >> NBIL01119126.1 Viola pubescens var. scabriuscula 5224394, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 20.9 5.8 2.7e-06 0.015 4 27 .. 793 816 .. 791 817 .] 0.92 Alignments for each domain: == domain 1 score: 20.9 bits; conditional E-value: 2.7e-06 CCEE-SSSS-SGGCCTEEEETTEE CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVC 27 C E+C+++pC++ +l C C+ +C NBIL01119126.1 793 CWETCFFFPCMSQLLKCYCNQVLC 816 99*****************87799 PP >> NBIL01142914.1 Viola pubescens var. scabriuscula 5255681, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 20.8 10.3 2.8e-06 0.015 3 28 .. 1534 1559 .. 1532 1561 .. 0.92 Alignments for each domain: == domain 1 score: 20.8 bits; conditional E-value: 2.8e-06 CCCEE-SSSS-SGGCCTEEEETTEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCy 28 +C E+C+++pC++++lGC C + +C+ NBIL01142914.1 1534 SCLETCFFFPCLSSLLGCACYSVICT 1559 699******************99**7 PP >> NBIL01041014.1 Viola pubescens var. scabriuscula 5094862, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 20.3 9.9 4.1e-06 0.022 5 30 .] 1 24 [. 1 24 [. 0.96 Alignments for each domain: == domain 1 score: 20.3 bits; conditional E-value: 4.1e-06 CEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 5 GEsCvyipCitavlGCsCkdkVCyrN 30 GEsCv+++C ++ GCsC +C +N NBIL01041014.1 1 GESCVLGTC--YTSGCSCVYGLCSKN 24 9********..*******988**998 PP >> NBIL01144957.1 Viola pubescens var. scabriuscula 5257837, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.7 16.9 1.4e-05 0.074 1 23 [. 539 560 .. 539 567 .. 0.93 Alignments for each domain: == domain 1 score: 18.7 bits; conditional E-value: 1.4e-05 BCC.CCEE-SSSS-SGGCCTEEEE CS Cyclotide 1 gip.CGEsCvyipCitavlGCsCk 23 g+p CGE+Cv ++C +++GCsC+ NBIL01144957.1 539 GLPvCGETCVGGTC--NTPGCSCS 560 6899**********..*******6 PP >> NBIL01137567.1 Viola pubescens var. scabriuscula 5250016, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.3 6.9 1.7e-05 0.094 4 27 .. 1651 1674 .. 1648 1677 .. 0.86 Alignments for each domain: == domain 1 score: 18.3 bits; conditional E-value: 1.7e-05 CCEE-SSSS-SGGCCTEEEETTEE CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVC 27 C E+Cv++pC++ +GC C + C NBIL01137567.1 1651 CWETCVFLPCYSKGIGCQCAWHYC 1674 99*****************76555 PP >> NBIL01123641.1 Viola pubescens var. scabriuscula 5231870, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.1 10.6 2e-05 0.11 1 30 [] 107 134 .. 107 134 .. 0.96 Alignments for each domain: == domain 1 score: 18.1 bits; conditional E-value: 2e-05 BCCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 1 gipCGEsCvyipCitavlGCsCkdkVCyrN 30 g++C EsC pC ++ GCsC+ + C++N NBIL01123641.1 107 GVFCYESCYDHPC--YTSGCSCTRSGCKKN 134 799**********..********99**998 PP >> NBIL01085128.1 Viola pubescens var. scabriuscula 5168114, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 17.7 2.0 2.7e-05 0.15 3 20 .. 5 22 .. 3 23 .. 0.89 Alignments for each domain: == domain 1 score: 17.7 bits; conditional E-value: 2.7e-05 CCCEE-SSSS-SGGCCTE CS Cyclotide 3 pCGEsCvyipCitavlGC 20 +C E+C+yipC++a C NBIL01085128.1 5 FCLETCIYIPCYSAFRKC 22 799**********98777 PP >> NBIL01084777.1 Viola pubescens var. scabriuscula 5167542, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 19.5 10.3 7.6e-06 0.042 3 24 .. 83 104 .. 81 109 .. 0.88 Alignments for each domain: == domain 1 score: 19.5 bits; conditional E-value: 7.6e-06 CCCEE-SSSS-SGGCCTEEEET CS Cyclotide 3 pCGEsCvyipCitavlGCsCkd 24 +C E+C+y+pC++ GC C+ NBIL01084777.1 83 FCFETCFYLPCYSKGTGCECER 104 699*****************85 PP >> NBIL01101387.1 Viola pubescens var. scabriuscula 5194943, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 17.9 8.5 2.3e-05 0.13 2 30 .] 100 129 .. 99 129 .. 0.91 Alignments for each domain: == domain 1 score: 17.9 bits; conditional E-value: 2.3e-05 CCCCEE-SSSS..-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyip..CitavlGCsCkdkVCyrN 30 + CG +C ++p C + C C++kVC +N NBIL01101387.1 100 VTCGPTCQFGPvnC-GINPRCNCRNKVCVLN 129 67*********766.999**********988 PP >> NBIL01044069.1 Viola pubescens var. scabriuscula 5099885, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.8 5.8 1.2e-05 0.066 3 28 .. 142 169 .. 140 170 .. 0.90 Alignments for each domain: == domain 1 score: 18.8 bits; conditional E-value: 1.2e-05 CCCEE-SSSS-SGGCCT..EEEETTEEE CS Cyclotide 3 pCGEsCvyipCitavlG..CsCkdkVCy 28 +C E+C++i C++ lG C+C C NBIL01044069.1 142 FCRETCFLIDCFSQFLGngCKCHTPMCQ 169 7**************9888***987995 PP >> NBIL01075772.1 Viola pubescens var. scabriuscula 5152414, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.0 8.7 2.2e-05 0.12 3 23 .. 72 92 .. 70 98 .. 0.88 Alignments for each domain: == domain 1 score: 18.0 bits; conditional E-value: 2.2e-05 CCCEE-SSSS-SGGCCTEEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCk 23 +C E+C++ipC++a+ C C NBIL01075772.1 72 FCFETCFVIPCYSAIRKCVCM 92 79******************5 PP >> NBIL01135436.1 Viola pubescens var. scabriuscula 5247742, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.6 8.1 1.5e-05 0.08 4 23 .. 612 631 .. 608 639 .. 0.84 Alignments for each domain: == domain 1 score: 18.6 bits; conditional E-value: 1.5e-05 CCEE-SSSS-SGGCCTEEEE CS Cyclotide 4 CGEsCvyipCitavlGCsCk 23 C E+Cv++pCit+++ CsC NBIL01135436.1 612 CWETCVLVPCITSIVDCSCY 631 99*****************6 PP >> NBIL01098987.1 Viola pubescens var. scabriuscula 5190990, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.5 8.5 1.5e-05 0.08 3 23 .. 94 114 .. 93 120 .. 0.90 Alignments for each domain: == domain 1 score: 18.5 bits; conditional E-value: 1.5e-05 CCCEE-SSSS-SGGCCTEEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCk 23 +C E+C+ ipC++ +GC C+ NBIL01098987.1 94 FCWETCFPIPCFSKGVGCECE 114 699*****************7 PP >> NBIL01070242.1 Viola pubescens var. scabriuscula 5143323, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.1 6.9 2e-05 0.11 4 23 .. 100 117 .. 97 132 .. 0.81 Alignments for each domain: == domain 1 score: 18.1 bits; conditional E-value: 2e-05 CCEE-SSSS-SGGCCTEEEE CS Cyclotide 4 CGEsCvyipCitavlGCsCk 23 CGE C ++C ++GCsC NBIL01070242.1 100 CGENCYSGSC--DTPGCSCA 117 **********..*******5 PP >> NBIL01003474.1 Viola pubescens var. scabriuscula 2475931, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 16.9 13.4 4.8e-05 0.26 3 27 .. 212 236 .. 210 238 .. 0.94 Alignments for each domain: == domain 1 score: 16.9 bits; conditional E-value: 4.8e-05 CCCEE-SSSS-SGGCCTEEEETTEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVC 27 +C E+Cv+ C ta +GC C +VC NBIL01003474.1 212 FCCETCVITACNTASIGCICFQNVC 236 8********************99** PP >> NBIL01155696.1 Viola pubescens var. scabriuscula 5268709, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.0 9.3 2.1e-05 0.12 3 22 .. 468 485 .. 466 487 .. 0.94 Alignments for each domain: == domain 1 score: 18.0 bits; conditional E-value: 2.1e-05 CCCEE-SSSS-SGGCCTEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsC 22 pCGE+C+ ++C +GC C NBIL01155696.1 468 PCGETCFSFSC--DNPGCYC 485 9**********..******* PP >> NBIL01029811.1 Viola pubescens var. scabriuscula 5076177, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 17.9 8.5 2.4e-05 0.13 4 30 .] 44 68 .. 40 68 .. 0.93 Alignments for each domain: == domain 1 score: 17.9 bits; conditional E-value: 2.4e-05 CCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVCyrN 30 C E C +ipC +GC C +k CyrN NBIL01029811.1 44 CKENCPIIPC--QYAGCFCVNKECYRN 68 99********..**************9 PP >> NBIL01055488.1 Viola pubescens var. scabriuscula 5118972, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 17.9 8.7 2.4e-05 0.13 3 23 .. 72 92 .. 70 98 .. 0.88 Alignments for each domain: == domain 1 score: 17.9 bits; conditional E-value: 2.4e-05 CCCEE-SSSS-SGGCCTEEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCk 23 +C E+C++ipC++a+ C C NBIL01055488.1 72 FCFETCFVIPCYSAIRKCVCM 92 79******************5 PP >> NBIL01029512.1 Viola pubescens var. scabriuscula 5075680, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.8 10.7 0.00011 0.58 3 30 .] 35 60 .. 33 60 .. 0.93 Alignments for each domain: == domain 1 score: 15.8 bits; conditional E-value: 0.00011 CCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCyrN 30 +C E+C ++ C +GCsC+ + Cy N NBIL01029512.1 35 FCQETCYVFGC--DRPGCSCSGSKCYIN 60 8**********..********999*987 PP >> NBIL01038672.1 Viola pubescens var. scabriuscula 5090936, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 17.6 8.5 2.8e-05 0.16 2 30 .] 31 60 .. 30 60 .. 0.91 2 ? 1.5 0.4 3.2 1.8e+04 7 14 .. 112 119 .. 112 125 .. 0.74 Alignments for each domain: == domain 1 score: 17.6 bits; conditional E-value: 2.8e-05 CCCCEE-SSSS..-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyip..CitavlGCsCkdkVCyrN 30 + CG +C ++p C + C C++kVC +N NBIL01038672.1 31 VTCGPTCQFGPvnC-GINPRCNCRNKVCVLN 60 67*********766.999**********988 PP == domain 2 score: 1.5 bits; conditional E-value: 3.2 E-SSSS-S CS Cyclotide 7 sCvyipCi 14 sC+++p++ NBIL01038672.1 112 SCFFFPFF 119 9*****72 PP >> NBIL01085784.1 Viola pubescens var. scabriuscula 5169206, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 17.5 8.2 3.1e-05 0.17 3 30 .] 111 136 .. 109 136 .. 0.93 2 ? 3.2 1.4 0.92 5e+03 6 14 .. 228 236 .. 225 239 .. 0.85 Alignments for each domain: == domain 1 score: 17.5 bits; conditional E-value: 3.1e-05 CCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCyrN 30 +CGE+C+ + C + C C+ C++N NBIL01085784.1 111 FCGETCRDLQC--GNPKCHCNYPMCTLN 136 8**********..*******988***98 PP == domain 2 score: 3.2 bits; conditional E-value: 0.92 EE-SSSS-S CS Cyclotide 6 EsCvyipCi 14 EsCv++ Ci NBIL01085784.1 228 ESCVLGLCI 236 ********4 PP >> NBIL01109837.1 Viola pubescens var. scabriuscula 5209027, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 16.8 10.3 5.2e-05 0.28 3 30 .] 86 111 .. 84 111 .. 0.95 Alignments for each domain: == domain 1 score: 16.8 bits; conditional E-value: 5.2e-05 CCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCyrN 30 +C EsC +pC + GCsCk Cy+N NBIL01109837.1 86 FCRESCYRFPC--RTGGCSCKGFGCYKN 111 7**********..********99***99 PP >> NBIL01055325.1 Viola pubescens var. scabriuscula 5118701, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 16.5 3.3 6.2e-05 0.34 2 21 .. 225 243 .. 223 247 .. 0.92 Alignments for each domain: == domain 1 score: 16.5 bits; conditional E-value: 6.2e-05 CCCCEE-SSSS.-SGGCCTEE CS Cyclotide 2 ipCGEsCvyip.CitavlGCs 21 i CGEsC++ p C ++lGC NBIL01055325.1 225 IRCGESCATNPvC--FTLGCQ 243 67***********..*****6 PP >> NBIL01076836.1 Viola pubescens var. scabriuscula 5154252, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.4 5.8 0.00014 0.75 7 21 .. 11 25 .. 11 25 .. 0.98 Alignments for each domain: == domain 1 score: 15.4 bits; conditional E-value: 0.00014 E-SSSS-SGGCCTEE CS Cyclotide 7 sCvyipCitavlGCs 21 sCv+ipCit v+GCs NBIL01076836.1 11 SCVFIPCITTVFGCS 25 9*************8 PP >> NBIL01118016.1 Viola pubescens var. scabriuscula 5222546, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.2 8.2 0.00017 0.91 2 30 .] 391 420 .. 389 420 .. 0.90 Alignments for each domain: == domain 1 score: 15.2 bits; conditional E-value: 0.00017 CCCCEE-SSSS..-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyip..CitavlGCsCkdkVCyrN 30 + CG +C ++p C + C C++kVC N NBIL01118016.1 391 VRCGPTCQFGPvnC-GINPSCNCRNKVCVMN 420 67*********766.99***********987 PP >> NBIL01060664.1 Viola pubescens var. scabriuscula 5127522, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 16.4 8.5 6.8e-05 0.37 2 30 .] 31 60 .. 30 60 .. 0.91 2 ? 0.4 0.4 6.7 3.7e+04 7 14 .. 112 119 .. 112 125 .. 0.74 Alignments for each domain: == domain 1 score: 16.4 bits; conditional E-value: 6.8e-05 CCCCEE-SSSS..-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyip..CitavlGCsCkdkVCyrN 30 + CG +C ++p C + C C++kVC +N NBIL01060664.1 31 VTCGPTCQFGPvnC-GINPRCNCRNKVCVLN 60 67*********766.999**********988 PP == domain 2 score: 0.4 bits; conditional E-value: 6.7 E-SSSS-S CS Cyclotide 7 sCvyipCi 14 sC+++p++ NBIL01060664.1 112 SCFFFPFF 119 9*****72 PP >> NBIL01156217.1 Viola pubescens var. scabriuscula 5269232, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 16.4 8.1 7e-05 0.38 3 27 .. 106 130 .. 104 132 .. 0.88 2 ? -0.0 0.2 9.3 5.1e+04 14 22 .. 867 875 .. 859 879 .. 0.75 Alignments for each domain: == domain 1 score: 16.4 bits; conditional E-value: 7e-05 CCCEE-SSSS-SGGCCTEEEETTEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVC 27 +C E+C++ipC++a +C C C NBIL01156217.1 106 FCWETCFFIPCVSAFRNCVCVKPAC 130 79******************75566 PP == domain 2 score: -0.0 bits; conditional E-value: 9.3 SGGCCTEEE CS Cyclotide 14 itavlGCsC 22 + ++ GC+C NBIL01156217.1 867 YLYLSGCKC 875 55889**** PP >> NBIL01015265.1 Viola pubescens var. scabriuscula 5052118, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.5 3.9 0.00013 0.71 1 18 [. 572 590 .. 572 591 .. 0.83 Alignments for each domain: == domain 1 score: 15.5 bits; conditional E-value: 0.00013 BCC.CCEE-SSSS-SGGCC CS Cyclotide 1 gip.CGEsCvyipCitavl 18 g+p CGE+Cv ++C t l NBIL01015265.1 572 GLPvCGETCVGGTCNTTPL 590 6899**********66655 PP >> NBIL01121910.1 Viola pubescens var. scabriuscula 5229025, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 16.0 4.2 9.5e-05 0.52 3 28 .. 30 55 .. 28 56 .. 0.89 Alignments for each domain: == domain 1 score: 16.0 bits; conditional E-value: 9.5e-05 CCCEE-SSSS-SGGCCTEEEETTEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCy 28 C E+C+++pC t +GC + +C+ NBIL01121910.1 30 YCIETCFLLPCRTGFIGCRYINPICK 55 699***************98888887 PP >> NBIL01107763.1 Viola pubescens var. scabriuscula 5205529, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.6 7.9 0.00026 1.4 3 22 .. 982 1001 .. 980 1006 .. 0.94 Alignments for each domain: == domain 1 score: 14.6 bits; conditional E-value: 0.00026 CCCEE-SSSS-SGGCCTEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsC 22 +C E+C+yipC++a +C C NBIL01107763.1 982 FCYETCIYIPCFSAFRNCVC 1001 699***************** PP >> NBIL01122265.1 Viola pubescens var. scabriuscula 5229602, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.8 11.8 0.00022 1.2 7 22 .. 96 111 .. 96 115 .. 0.96 Alignments for each domain: == domain 1 score: 14.8 bits; conditional E-value: 0.00022 E-SSSS-SGGCCTEEE CS Cyclotide 7 sCvyipCitavlGCsC 22 sCv+ipCit ++GCsC NBIL01122265.1 96 SCVFIPCITTIFGCSC 111 9*************** PP >> NBIL01146563.1 Viola pubescens var. scabriuscula 5259536, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.9 6.6 9.9e-05 0.54 3 28 .. 142 169 .. 140 170 .. 0.91 Alignments for each domain: == domain 1 score: 15.9 bits; conditional E-value: 9.9e-05 CCCEE-SSSS-SGGCCT..EEEETTEEE CS Cyclotide 3 pCGEsCvyipCitavlG..CsCkdkVCy 28 +C E+C++ C++ lG C+C + VC NBIL01146563.1 142 FCWETCFLTDCFSQFLGngCKCYALVCQ 169 799************9888***999**6 PP >> NBIL01148087.1 Viola pubescens var. scabriuscula 5261078, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.8 9.9 0.00022 1.2 3 22 .. 281 300 .. 279 306 .. 0.93 Alignments for each domain: == domain 1 score: 14.8 bits; conditional E-value: 0.00022 CCCEE-SSSS-SGGCCTEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsC 22 +C E+C++ipC++a+ C C NBIL01148087.1 281 FCYETCFVIPCYSAIKKCVC 300 79****************** PP >> NBIL01122076.1 Viola pubescens var. scabriuscula 5229290, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.7 4.2 0.00011 0.6 3 28 .. 19 44 .. 17 45 .. 0.89 Alignments for each domain: == domain 1 score: 15.7 bits; conditional E-value: 0.00011 CCCEE-SSSS-SGGCCTEEEETTEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCy 28 C E+C+++pC t +GC + +C+ NBIL01122076.1 19 YCIETCFLLPCRTGFIGCRYINPICK 44 699***************98888887 PP >> NBIL01094774.1 Viola pubescens var. scabriuscula 5184124, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.7 4.2 0.00011 0.62 3 28 .. 19 44 .. 17 45 .. 0.89 Alignments for each domain: == domain 1 score: 15.7 bits; conditional E-value: 0.00011 CCCEE-SSSS-SGGCCTEEEETTEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCy 28 C E+C+++pC t +GC + +C+ NBIL01094774.1 19 YCIETCFLLPCRTGFIGCRYINPICK 44 699***************98888887 PP >> NBIL01145717.1 Viola pubescens var. scabriuscula 5258639, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.4 9.2 0.00029 1.6 3 23 .. 453 473 .. 451 480 .. 0.88 Alignments for each domain: == domain 1 score: 14.4 bits; conditional E-value: 0.00029 CCCEE-SSSS-SGGCCTEEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCk 23 +C E+C++ +C+++++GC C NBIL01145717.1 453 SCFETCFVSSCLSSLIGCACY 473 69******************6 PP >> NBIL01064801.1 Viola pubescens var. scabriuscula 5134334, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.5 7.1 0.00013 0.7 3 27 .. 25 51 .. 23 53 .. 0.88 Alignments for each domain: == domain 1 score: 15.5 bits; conditional E-value: 0.00013 CCCEE-SSSS-SGGCCT..EEEETTEE CS Cyclotide 3 pCGEsCvyipCitavlG..CsCkdkVC 27 +C E+C++i C++ lG C+C C NBIL01064801.1 25 FCWETCFLIDCFSQFLGngCKCHTPTC 51 799************9888***86677 PP >> NBIL01145718.1 Viola pubescens var. scabriuscula 5258640, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.5 9.2 0.00026 1.4 3 23 .. 405 425 .. 403 432 .. 0.88 Alignments for each domain: == domain 1 score: 14.5 bits; conditional E-value: 0.00026 CCCEE-SSSS-SGGCCTEEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCk 23 +C E+C++ +C+++++GC C NBIL01145718.1 405 SCFETCFVSSCLSSLIGCACY 425 69******************6 PP >> NBIL01119822.1 Viola pubescens var. scabriuscula 5225588, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.0 2.6 0.00038 2.1 6 26 .. 369 390 .. 368 391 .. 0.85 Alignments for each domain: == domain 1 score: 14.0 bits; conditional E-value: 0.00038 EE-.SSSS-SGGCCTEEEETTE CS Cyclotide 6 EsC.vyipCitavlGCsCkdkV 26 EsC v++ Cit ++ CsC+ +V NBIL01119822.1 369 ESCeVMLDCITRTIHCSCTRNV 390 99*66777**********8665 PP >> NBIL01145951.1 Viola pubescens var. scabriuscula 5258885, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.4 3.3 0.00014 0.77 2 21 .. 180 198 .. 178 202 .. 0.92 Alignments for each domain: == domain 1 score: 15.4 bits; conditional E-value: 0.00014 CCCCEE-SSSS.-SGGCCTEE CS Cyclotide 2 ipCGEsCvyip.CitavlGCs 21 i CGEsC++ p C ++lGC NBIL01145951.1 180 IRCGESCATNPvC--FTLGCQ 198 67***********..*****6 PP >> NBIL01145716.1 Viola pubescens var. scabriuscula 5258638, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 13.9 9.2 0.00041 2.3 3 23 .. 77 97 .. 75 104 .. 0.88 Alignments for each domain: == domain 1 score: 13.9 bits; conditional E-value: 0.00041 CCCEE-SSSS-SGGCCTEEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCk 23 +C E+C++ +C+++++GC C NBIL01145716.1 77 SCFETCFVSSCLSSLIGCACY 97 69******************6 PP >> NBIL01079517.1 Viola pubescens var. scabriuscula 5158755, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 6.9 5.2 0.064 3.5e+02 1 22 [. 49 68 .. 49 73 .. 0.89 2 ? 14.7 9.6 0.00023 1.3 2 30 .] 75 100 .. 74 100 .. 0.94 Alignments for each domain: == domain 1 score: 6.9 bits; conditional E-value: 0.064 BCCCCEE-SSSS-SGGCCTEEE CS Cyclotide 1 gipCGEsCvyipCitavlGCsC 22 g+ C E+Cv+ C + C C NBIL01079517.1 49 GVYCSETCVVDVC--RPAKCPC 68 578**********..9999999 PP == domain 2 score: 14.7 bits; conditional E-value: 0.00023 CCCCEE-SSSS-SGGCCTEEEETTEEEET CS Cyclotide 2 ipCGEsCvyipCitavlGCsCkdkVCyrN 30 + C EsCv+ C + +GC C +Cy N NBIL01079517.1 75 VYCTESCVVDACRPEKIGCYC---ICYSN 100 56*******************...9**98 PP >> NBIL01005937.1 Viola pubescens var. scabriuscula 4213610, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.2 0.7 0.00035 1.9 2 13 .. 109 120 .. 108 125 .. 0.90 Alignments for each domain: == domain 1 score: 14.2 bits; conditional E-value: 0.00035 CCCCEE-SSSS- CS Cyclotide 2 ipCGEsCvyipC 13 ++CGEsCv + C NBIL01005937.1 109 VFCGESCVSMGC 120 89*******999 PP >> NBIL01078894.1 Viola pubescens var. scabriuscula 5157705, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.7 6.5 0.001 5.5 4 23 .. 170 189 .. 166 192 .. 0.91 Alignments for each domain: == domain 1 score: 12.7 bits; conditional E-value: 0.001 CCEE-SSSS-SGGCCTEEEE CS Cyclotide 4 CGEsCvyipCitavlGCsCk 23 CGEsC + C + + CsC NBIL01078894.1 170 CGESCTVSECSGFSPYCSCW 189 **********99*******6 PP >> NBIL01081890.1 Viola pubescens var. scabriuscula 5162720, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.2 8.5 0.0029 16 3 28 .. 1711 1736 .. 1710 1737 .. 0.93 Alignments for each domain: == domain 1 score: 11.2 bits; conditional E-value: 0.0029 CCCEE-SSSS-SGGCCTEEEETTEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsCkdkVCy 28 +C E+C y C++ + C Ck +C+ NBIL01081890.1 1711 SCQETCSYSRCFSRLSKCYCKKGLCK 1736 599*****************977**7 PP >> NBIL01047529.1 Viola pubescens var. scabriuscula 5105709, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.6 8.0 0.0022 12 3 22 .. 164 181 .. 161 182 .. 0.92 Alignments for each domain: == domain 1 score: 11.6 bits; conditional E-value: 0.0022 CCCEE-SSSS-SGGCCTEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsC 22 CGE+C++ C + C C NBIL01047529.1 164 ACGETCFTSHC--TDPACVC 181 5**********..99***99 PP >> NBIL01119716.1 Viola pubescens var. scabriuscula 5225396, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.6 8.6 0.0023 12 3 22 .. 260 279 .. 258 285 .. 0.93 Alignments for each domain: == domain 1 score: 11.6 bits; conditional E-value: 0.0023 CCCEE-SSSS-SGGCCTEEE CS Cyclotide 3 pCGEsCvyipCitavlGCsC 22 +C E+C+++pC++a C C NBIL01119716.1 260 FCYETCFLVPCYSAFKKCVC 279 79****************** PP >> NBIL01119282.1 Viola pubescens var. scabriuscula 5224658, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 10.9 2.7 0.0035 19 3 21 .. 67 84 .. 65 92 .. 0.71 Alignments for each domain: == domain 1 score: 10.9 bits; conditional E-value: 0.0035 CCCEE-SSSS-SGGCCTEE CS Cyclotide 3 pCGEsCvyipCitavlGCs 21 +C E+C+++pC+ ++ Cs NBIL01119282.1 67 FCWETCFVVPCY-IAFKCS 84 799********3.344565 PP >> NBIL01052692.1 Viola pubescens var. scabriuscula 5114338, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 10.7 11.2 0.0043 24 4 28 .. 320 340 .. 317 341 .. 0.91 Alignments for each domain: == domain 1 score: 10.7 bits; conditional E-value: 0.0043 CCEE-SSSS-SGGCCTEEEETTEEE CS Cyclotide 4 CGEsCvyipCitavlGCsCkdkVCy 28 CG +C+yi+C lGCsC dk Cy NBIL01052692.1 320 CG-TCRYISC---DLGCSCYDKSCY 340 77.9******...***********9 PP >> NBIL01131936.1 Viola pubescens var. scabriuscula 5244018, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 10.7 0.3 0.004 22 12 29 .. 23 41 .. 19 42 .. 0.88 2 ? 2.4 0.5 1.6 8.7e+03 6 13 .. 236 243 .. 235 251 .. 0.85 Alignments for each domain: == domain 1 score: 10.7 bits; conditional E-value: 0.004 S-.SGGCCTEEEETTEEEE CS Cyclotide 12 pC.itavlGCsCkdkVCyr 29 +C +t G sC+++VCy+ NBIL01131936.1 23 SCfLTLPRGASCDSSVCYK 41 588899999*********8 PP == domain 2 score: 2.4 bits; conditional E-value: 1.6 EE-SSSS- CS Cyclotide 6 EsCvyipC 13 EsC+ i C NBIL01131936.1 236 ESCIHIGC 243 9******9 PP >> NBIL01051119.1 Viola pubescens var. scabriuscula 5111739, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 9.2 4.8 0.012 67 4 22 .. 444 466 .. 441 468 .. 0.90 Alignments for each domain: == domain 1 score: 9.2 bits; conditional E-value: 0.012 CCEE-SS....SS-SGGCCTEEE CS Cyclotide 4 CGEsCvy....ipCitavlGCsC 22 C EsCv+ +pC++ v+ CsC NBIL01051119.1 444 CEESCVWptihLPCFSRVVPCSC 466 99****9887789********** PP Our Antibacterial Solanaceae not in Cybase >> JAFBXY010011193.1 Petunia secreta isolate 01A Psec_k119Scf2366595, whole genome shotgun sequence_chunk_0_F2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.2 2.4 3.5e+06 9 15 .. 789 795 .. 788 797 .. 0.88 2 ! 57.4 11.1 1.3e-18 1.8e-12 1 30 [] 3089 3119 .. 3089 3119 .. 0.97 3 ? 0.8 0.0 0.63 9e+05 9 25 .. 5618 5635 .. 5616 5636 .. 0.86 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 2.4 Alignment 9 VfIPCis 15 ++IPCis JAFBXY010011193.1 789 IYIPCIS 795 69****8 PP == domain 2 score: 57.4 bits; conditional E-value: 1.3e-18 Alignment 1 sIPCGESCVfIPCis.allGCSCKsKVCYrN 30 +IPCGESCV+IPC+ allGCSC +K+CY+N JAFBXY010011193.1 3089 GIPCGESCVWIPCTTtALLGCSCSNKICYKN 3119 7*************999*************9 PP == domain 3 score: 0.8 bits; conditional E-value: 0.63 Alignment 9 VfIPCis.allGCSCKsK 25 Vf P ll C CK+K JAFBXY010011193.1 5618 VFAPNLRyKLLICDCKNK 5635 788888878999*****9 PP >> JACAFL010121731.1 Petunia axillaris subsp. parodii cultivar S7 scaffold121731, whole genome shotgun sequence_chunk_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.0 4.9 7e+06 15 28 .. 2288 2301 .. 2287 2301 .. 0.86 2 ! 53.3 14.0 2.4e-17 3.5e-11 1 30 [] 3355 3384 .. 3355 3384 .. 0.98 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 4.9 Alignment 15 sallGCSCKsKVCY 28 +++GC s VC+ JACAFL010121731.1 2288 TSIIGCEFPSFVCF 2301 589****9999996 PP >> JAFBXY010004347.1 Petunia secreta isolate 01A Psec_k119Scf2413791, whole genome shotgun sequence_chunk_0_F1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 48.8 15.6 6.3e-16 9e-10 1 30 [] 4232 4261 .. 4232 4261 .. 0.98 Alignments for each domain: == domain 1 score: 48.8 bits; conditional E-value: 6.3e-16 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 +IPCG SC++IPCis+ +GCSC++KVCY N JAFBXY010004347.1 4232 GIPCGKSCIWIPCISSTVGCSCRNKVCYSN 4261 7***************************98 PP >> JACAFL010018638.1 Petunia axillaris subsp. parodii cultivar S7 scaffold18638, whole genome shotgun sequence_chunk_0_ # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.4 11.7 2.5e-13 3.6e-07 4 30 .] 5362 5388 .. 5359 5388 .. 0.95 Alignments for each domain: == domain 1 score: 40.4 bits; conditional E-value: 2.5e-13 Alignment 4 CGESCVfIPCisallGCSCKsKVCYrN 30 CGESCV+IPC sa +GCSC + +CY N JACAFL010018638.1 5362 CGESCVWIPCLSASIGCSCSNMICYLN 5388 *************************87 PP >> JACAFL010092276.1 Petunia axillaris subsp. parodii cultivar S7 scaffold92276, whole genome shotgun sequence_chunk_0_ # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.1 7.6 5.9e-12 8.5e-06 4 29 .. 2443 2469 .. 2441 2470 .. 0.94 Alignments for each domain: == domain 1 score: 36.1 bits; conditional E-value: 5.9e-12 Alignment 4 CGESCVfIPCis.allGCSCKsKVCYr 29 CGE CV+IPC+ allGCSC +KVC r JACAFL010092276.1 2443 CGEPCVYIPCTItALLGCSCLNKVCVR 2469 **********9989***********77 PP >> JAFBXY010008453.1 Petunia secreta isolate 01A Psec_k119Scf2398299, whole genome shotgun sequence_chunk_0_F1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.3 9.3 1.1e-11 1.5e-05 4 29 .. 7479 7505 .. 7476 7506 .. 0.93 Alignments for each domain: == domain 1 score: 35.3 bits; conditional E-value: 1.1e-11 Alignment 4 CGESCVfIPCis.allGCSCKsKVCYr 29 CGESC +IPC++ a+ GC C +KVC + JAFBXY010008453.1 7479 CGESCLWIPCTVtAAFGCYCSNKVCVK 7505 ************99***********76 PP >> JAFBXY010041265.1 Petunia secreta isolate 01A Psec_k119Scf2416639, whole genome shotgun sequence_chunk_0_F2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.5 11.7 7.5e-11 0.00011 1 27 [. 1128 1154 .. 1128 1158 .. 0.88 Alignments for each domain: == domain 1 score: 32.5 bits; conditional E-value: 7.5e-11 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVC 27 sI C ESCV+IPC +l+GCSC + C JAFBXY010041265.1 1128 SISCAESCVWIPCATSLIGCSCVNSRC 1154 799*******************98777 PP >> JACAFL010007464.1 Petunia axillaris subsp. parodii cultivar S7 scaffold7464, whole genome shotgun sequence_chunk_0_F # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 23.5 11.5 5.1e-08 0.073 1 27 [. 597 623 .. 597 625 .. 0.91 2 ? -1.1 1.1 2.5 3.6e+06 9 14 .. 2303 2308 .. 2302 2310 .. 0.87 Alignments for each domain: == domain 1 score: 23.5 bits; conditional E-value: 5.1e-08 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVC 27 sI C ESC fIPC a++GCSC + C JACAFL010007464.1 597 SITCIESCLFIPCATAIIGCSCINGRC 623 699*******************88666 PP >> JAFBXY010047406.1 Petunia secreta isolate 01A Psec_k119Scf2425175, whole genome shotgun sequence_chunk_0_F0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 17.9 3.7 2.8e-06 4.1 3 27 .. 947 971 .. 945 973 .. 0.95 Alignments for each domain: == domain 1 score: 17.9 bits; conditional E-value: 2.8e-06 Alignment 3 PCGESCVfIPCisallGCSCKsKVC 27 CG SC++IP s + G C +K C JAFBXY010047406.1 947 TCGGSCIWIPYLSGIAGYHCVNKMC 971 6************************ PP >> MDKG01742428.1 Nicotiana rustica Nrus_contig359346, whole genome shotgun sequence_chunk_0_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 19.1 1.8 1.2e-06 1.7 10 28 .. 4 25 .. 3 26 .. 0.85 Alignments for each domain: == domain 1 score: 19.1 bits; conditional E-value: 1.2e-06 Alignment 10 fIPCisa...llGCSCKsKVCY 28 f+PCi + +lG SC sK CY MDKG01742428.1 4 FLPCIRTctrALGISCASKACY 25 99**9843348*********** PP >> JACAFL010186355.1 Petunia axillaris subsp. parodii cultivar S7 scaffold187367, whole genome shotgun sequence_chunk_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 19.1 3.8 1.2e-06 1.7 11 29 .. 1 20 [. 1 21 [. 0.94 Alignments for each domain: == domain 1 score: 19.1 bits; conditional E-value: 1.2e-06 Alignment 11 IPCis.allGCSCKsKVCYr 29 IPC++ a+ GC C +KVC + JACAFL010186355.1 1 IPCTVtAAFGCYCSNKVCVK 20 9****99***********76 PP >> PGPE01380667.1 Nicotiana glauca isolate Gk001 jcf7180010617752, whole genome shotgun sequence_chunk_0_F0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 5.7 0.5 0.019 2.7e+04 7 12 .. 1 6 [. 1 7 [. 0.94 2 ? 5.4 0.0 0.024 3.4e+04 6 12 .. 43 49 .. 41 52 .. 0.87 3 ? 7.9 0.1 0.0038 5.5e+03 6 12 .. 140 146 .. 138 150 .. 0.85 == domain 2 score: 5.4 bits; conditional E-value: 0.024 Alignment 6 ESCVfIP 12 SCV++P PGPE01380667.1 43 NSCVWVP 49 59****9 PP == domain 3 score: 7.9 bits; conditional E-value: 0.0038 Alignment 6 ESCVfIP 12 SCV+IP PGPE01380667.1 140 NSCVWIP 146 59***** PP >> PGPE01308337.1 Nicotiana glauca isolate Gk001 jcf7180010545394, whole genome shotgun sequence_chunk_0_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 4.2 0.2 0.054 7.8e+04 6 12 .. 221 227 .. 219 232 .. 0.86 2 ? 4.4 0.0 0.047 6.8e+04 6 13 .. 317 324 .. 315 329 .. 0.85 3 ? 10.4 0.2 0.00064 9.3e+02 6 14 .. 413 421 .. 411 426 .. 0.86 Alignments for each domain: == domain 1 score: 4.2 bits; conditional E-value: 0.054 Alignment 6 ESCVfIP 12 SCV++P PGPE01308337.1 221 NSCVWVP 227 59***** PP == domain 2 score: 4.4 bits; conditional E-value: 0.047 Alignment 6 ESCVfIPC 13 SCV++P PGPE01308337.1 317 NSCVWVPG 324 59*****5 PP == domain 3 score: 10.4 bits; conditional E-value: 0.00064 Alignment 6 ESCVfIPCi 14 SCV++PC PGPE01308337.1 413 NSCVWVPCL 421 59******7 PP >> PGPE01415148.1 Nicotiana glauca isolate Gk001 jcf7180010652247, whole genome shotgun sequence_chunk_0_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 4.1 0.1 0.058 8.4e+04 6 12 .. 28 34 .. 26 38 .. 0.85 2 ? 10.1 0.2 0.00079 1.1e+03 6 14 .. 125 133 .. 123 137 .. 0.87 3 ? 4.1 0.1 0.058 8.4e+04 6 12 .. 270 276 .. 268 280 .. 0.85 Alignments for each domain: == domain 1 score: 4.1 bits; conditional E-value: 0.058 Alignment 6 ESCVfIP 12 SCV++P PGPE01415148.1 28 NSCVWVP 34 59***** PP == domain 2 score: 10.1 bits; conditional E-value: 0.00079 Alignment 6 ESCVfIPCi 14 SCV++PC PGPE01415148.1 125 NSCVWVPCL 133 59******7 PP == domain 3 score: 4.1 bits; conditional E-value: 0.058 Alignment 6 ESCVfIP 12 SCV++P PGPE01415148.1 270 NSCVWVP 276 59***** PP >> WBIC01251349.1 Solanum chaucha cha_contig251475, whole genome shotgun sequence_chunk_0_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 16.7 0.1 6.9e-06 9.9 8 30 .] 55 78 .. 54 78 .. 0.95 Alignments for each domain: == domain 1 score: 16.7 bits; conditional E-value: 6.9e-06 Alignment 8 CVfIPCis.allGCSCKsKVCYrN 30 C +IPCi+ lG S KV Y N WBIC01251349.1 55 CTHIPCIVhQELGPSHEQKVTYSN 78 99******99************98 PP >> PGPE01321292.1 Nicotiana glauca isolate Gk001 jcf7180010558357, whole genome shotgun sequence_chunk_0_F1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 5.2 0.1 0.027 3.9e+04 6 12 .. 12 18 .. 10 22 .. 0.85 2 ? 4.6 0.1 0.042 6e+04 6 12 .. 60 66 .. 58 69 .. 0.89 3 ? 6.6 0.1 0.0095 1.4e+04 6 12 .. 157 163 .. 155 166 .. 0.89 Alignments for each domain: == domain 1 score: 5.2 bits; conditional E-value: 0.027 Alignment 6 ESCVfIP 12 SCV++P PGPE01321292.1 12 NSCVWVP 18 59***** PP == domain 2 score: 4.6 bits; conditional E-value: 0.042 Alignment 6 ESCVfIP 12 SCV++P PGPE01321292.1 60 NSCVWVP 66 59****9 PP == domain 3 score: 6.6 bits; conditional E-value: 0.0095 Alignment 6 ESCVfIP 12 SCV+IP PGPE01321292.1 157 NSCVWIP 163 59****9 PP >> AWOL01S0156723.1 Nicotiana otophora Noto_scaffold156723, whole genome shotgun sequence_chunk_0_F1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 3.0 0.1 0.13 1.8e+05 7 14 .. 369 376 .. 368 379 .. 0.86 2 ? 3.1 0.1 0.12 1.8e+05 7 14 .. 397 404 .. 395 407 .. 0.87 3 ? 3.1 0.1 0.12 1.8e+05 7 14 .. 425 432 .. 423 435 .. 0.87 4 ? 3.1 0.1 0.12 1.8e+05 7 14 .. 453 460 .. 451 463 .. 0.87 5 ? 3.1 0.1 0.12 1.8e+05 7 14 .. 481 488 .. 479 491 .. 0.87 6 ? 3.1 0.1 0.12 1.8e+05 7 14 .. 509 516 .. 507 519 .. 0.87 7 ? 3.1 0.1 0.12 1.8e+05 7 14 .. 537 544 .. 535 547 .. 0.87 8 ? 3.1 0.1 0.12 1.8e+05 7 14 .. 565 572 .. 563 575 .. 0.87 9 ? 0.8 0.0 0.64 9.2e+05 7 14 .. 614 621 .. 613 624 .. 0.86 Alignments for each domain: == domain 1 score: 3.0 bits; conditional E-value: 0.13 Alignment 7 SCVfIPCi 14 S Vf+PCi AWOL01S0156723.1 369 SHVFVPCI 376 67*****9 PP == domain 2 score: 3.1 bits; conditional E-value: 0.12 Alignment 7 SCVfIPCi 14 S Vf+PCi AWOL01S0156723.1 397 SHVFVPCI 404 67*****9 PP == domain 3 score: 3.1 bits; conditional E-value: 0.12 Alignment 7 SCVfIPCi 14 S Vf+PCi AWOL01S0156723.1 425 SHVFVPCI 432 67*****9 PP == domain 4 score: 3.1 bits; conditional E-value: 0.12 Alignment 7 SCVfIPCi 14 S Vf+PCi AWOL01S0156723.1 453 SHVFVPCI 460 67*****9 PP == domain 5 score: 3.1 bits; conditional E-value: 0.12 Alignment 7 SCVfIPCi 14 S Vf+PCi AWOL01S0156723.1 481 SHVFVPCI 488 67*****9 PP == domain 6 score: 3.1 bits; conditional E-value: 0.12 Alignment 7 SCVfIPCi 14 S Vf+PCi AWOL01S0156723.1 509 SHVFVPCI 516 67*****9 PP == domain 7 score: 3.1 bits; conditional E-value: 0.12 Alignment 7 SCVfIPCi 14 S Vf+PCi AWOL01S0156723.1 537 SHVFVPCI 544 67*****9 PP == domain 8 score: 3.1 bits; conditional E-value: 0.12 Alignment 7 SCVfIPCi 14 S Vf+PCi AWOL01S0156723.1 565 SHVFVPCI 572 67*****9 PP == domain 9 score: 0.8 bits; conditional E-value: 0.64 Alignment 7 SCVfIPCi 14 S Vf PCi AWOL01S0156723.1 614 SHVFAPCI 621 67*****9 PP >> PGPE01359046.1 Nicotiana glauca isolate Gk001 jcf7180010596125, whole genome shotgun sequence_chunk_0_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 4.8 0.1 0.035 5e+04 6 12 .. 22 28 .. 20 32 .. 0.85 2 ? 4.8 0.0 0.034 4.9e+04 6 12 .. 263 269 .. 261 274 .. 0.86 3 ? 5.9 0.1 0.016 2.3e+04 6 12 .. 311 317 .] 309 317 .] 0.90 Alignments for each domain: == domain 1 score: 4.8 bits; conditional E-value: 0.035 Alignment 6 ESCVfIP 12 SCV++P PGPE01359046.1 22 NSCVWVP 28 59***** PP == domain 2 score: 4.8 bits; conditional E-value: 0.034 Alignment 6 ESCVfIP 12 SCV++P PGPE01359046.1 263 NSCVWVP 269 59***** PP == domain 3 score: 5.9 bits; conditional E-value: 0.016 Alignment 6 ESCVfIP 12 SCV+IP PGPE01359046.1 311 NSCVWIP 317 59****9 PP >> PGPE01338283.1 Nicotiana glauca isolate Gk001 jcf7180010575359, whole genome shotgun sequence_chunk_0_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 3.8 0.1 0.074 1.1e+05 6 12 .. 48 54 .. 46 58 .. 0.85 2 ? -0.1 0.0 1.2 1.7e+06 6 11 .. 88 93 .. 86 96 .. 0.85 3 ? 3.6 0.0 0.085 1.2e+05 6 12 .. 195 201 .. 193 208 .. 0.86 4 ? 3.8 0.1 0.074 1.1e+05 6 12 .. 235 241 .. 233 245 .. 0.85 5 ? 3.3 0.0 0.1 1.5e+05 6 12 .. 275 281 .. 273 284 .. 0.88 6 ? 3.7 0.1 0.076 1.1e+05 6 12 .. 460 466 .. 458 469 .. 0.85 Alignments for each domain: == domain 1 score: 3.8 bits; conditional E-value: 0.074 Alignment 6 ESCVfIP 12 SCV++P PGPE01338283.1 48 NSCVWVP 54 59***** PP == domain 2 score: -0.1 bits; conditional E-value: 1.2 Alignment 6 ESCVfI 11 SCV++ PGPE01338283.1 88 NSCVWV 93 59***7 PP == domain 3 score: 3.6 bits; conditional E-value: 0.085 Alignment 6 ESCVfIP 12 SCV++P PGPE01338283.1 195 NSCVWVP 201 59****9 PP == domain 4 score: 3.8 bits; conditional E-value: 0.074 Alignment 6 ESCVfIP 12 SCV++P PGPE01338283.1 235 NSCVWVP 241 59***** PP == domain 5 score: 3.3 bits; conditional E-value: 0.1 Alignment 6 ESCVfIP 12 SCV++P PGPE01338283.1 275 NSCVWVP 281 59****9 PP == domain 6 score: 3.7 bits; conditional E-value: 0.076 Alignment 6 ESCVfIP 12 SCV++P PGPE01338283.1 460 NSCVWVP 466 59****9 PP >> AWOL01S0795838.1 Nicotiana otophora Noto_scaffold795838, whole genome shotgun sequence_chunk_0_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 16.1 1.5 1.1e-05 15 14 28 .. 35 49 .. 34 50 .. 0.90 Alignments for each domain: == domain 1 score: 16.1 bits; conditional E-value: 1.1e-05 Alignment 14 isallGCSCKsKVCY 28 +++l CSC s+VCY AWOL01S0795838.1 35 TATLFTCSCSSRVCY 49 57999********** PP >> AWOL01S0516558.1 Nicotiana otophora Noto_scaffold516558, whole genome shotgun sequence_chunk_0_F0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.4 1.1 1.7e-05 24 6 15 .. 97 106 .. 96 111 .. 0.89 Alignments for each domain: == domain 1 score: 15.4 bits; conditional E-value: 1.7e-05 Alignment 6 ESCVfIPCis 15 ESCVfIPC s AWOL01S0516558.1 97 ESCVFIPCLS 106 9*******98 PP >> PGPE01060046.1 Nicotiana glauca isolate Gk001 jcf7180010296752, whole genome shotgun sequence_chunk_0_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 5.1 0.0 0.029 4.1e+04 6 12 .. 78 84 .. 76 87 .. 0.87 2 ? 11.1 0.5 0.00037 5.4e+02 6 14 .. 175 183 .. 173 187 .. 0.87 Alignments for each domain: == domain 1 score: 5.1 bits; conditional E-value: 0.029 Alignment 6 ESCVfIP 12 SCV++P PGPE01060046.1 78 NSCVWVP 84 59****9 PP == domain 2 score: 11.1 bits; conditional E-value: 0.00037 Alignment 6 ESCVfIPCi 14 SCV++PC PGPE01060046.1 175 NSCVWVPCL 183 59******7 PP >> MDKG01469402.1 Nicotiana rustica Nrus_contig218731, whole genome shotgun sequence_chunk_0_F1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 3.5 0.1 0.089 1.3e+05 6 11 .. 25 30 .. 21 32 .. 0.89 2 ? 11.0 0.0 0.00039 5.6e+02 17 29 .. 83 95 .. 81 96 .. 0.90 == domain 2 score: 11.0 bits; conditional E-value: 0.00039 Alignment 17 llGCSCKsKVCYr 29 ++GCS +s VC r MDKG01469402.1 83 IIGCSLRSQVCLR 95 69*********88 PP >> WBIH01202594.1 Solanum x curtilobum cur_202594, whole genome shotgun sequence_chunk_0_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.2 5.9 2e-05 29 4 23 .. 176 195 .. 174 196 .. 0.82 Alignments for each domain: == domain 1 score: 15.2 bits; conditional E-value: 2e-05 Alignment 4 CGESCVfIPCisallGCSCK 23 G I Cis+l+GCSCK WBIH01202594.1 176 SGSTSFIISCISSLVGCSCK 195 566666799**********9 PP Our antibacterial Viola Pubescens not in Cybase >> NBIL01157303.1 Viola pubescens var. scabriuscula 5270322, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.5 12.2 1.1e-19 1.1e-15 1 30 [] 28 57 .. 28 57 .. 0.98 2 ! 15.4 6.9 6.2e-05 0.63 4 30 .] 642 668 .. 641 668 .. 0.98 Alignments for each domain: == domain 1 score: 62.5 bits; conditional E-value: 1.1e-19 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 +IPCGESCV+IPC a++GCSCK KVCYrN NBIL01157303.1 28 GIPCGESCVYIPCLTAAIGCSCKKKVCYRN 57 7****************************9 PP == domain 2 score: 15.4 bits; conditional E-value: 6.2e-05 Alignment 4 CGESCVfIPCisallGCSCKsKVCYrN 30 CGE CV P s++ GC C + C +N NBIL01157303.1 642 CGETCVSFPYFSSARGCGCHNLGCIKN 668 ************************998 PP >> NBIL01054408.1 Viola pubescens var. scabriuscula 5117130, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.6 12.8 1.4e-21 1.4e-17 1 30 [] 111 140 .. 111 140 .. 0.97 Alignments for each domain: == domain 1 score: 68.6 bits; conditional E-value: 1.4e-21 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 ++PCGESCV+IPCisa++GCSCKsKVCYrN NBIL01054408.1 111 GMPCGESCVWIPCISAAVGCSCKSKVCYRN 140 58***************************9 PP >> NBIL01034143.1 Viola pubescens var. scabriuscula 5083416, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.2 14.1 8e-21 8.1e-17 1 30 [] 25 54 .. 25 54 .. 0.98 Alignments for each domain: == domain 1 score: 66.2 bits; conditional E-value: 8e-21 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 ++PCGESCV+IPCi a++GCSCKsKVCY+N NBIL01034143.1 25 VVPCGESCVWIPCITAAIGCSCKSKVCYKN 54 69***************************9 PP >> NBIL01029989.1 Viola pubescens var. scabriuscula 5076473, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.8 13.8 5.2e-21 5.3e-17 1 30 [] 14 43 .. 14 43 .. 0.98 Alignments for each domain: == domain 1 score: 66.8 bits; conditional E-value: 5.2e-21 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 +IPCGESCV+IPCi ++GCSCKsKVCYrN NBIL01029989.1 14 GIPCGESCVWIPCITRVIGCSCKSKVCYRN 43 7****************************9 PP >> NBIL01117794.1 Viola pubescens var. scabriuscula 5222147, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.1 16.0 4.1e-21 4.2e-17 1 30 [] 215 244 .. 215 244 .. 0.98 Alignments for each domain: == domain 1 score: 67.1 bits; conditional E-value: 4.1e-21 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 +IPCGESCVfIPCis+++GCSCKsKVCYrN NBIL01117794.1 215 VIPCGESCVFIPCISSVVGCSCKSKVCYRN 244 7****************************9 PP >> NBIL01038969.1 Viola pubescens var. scabriuscula 5091425, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.7 14.1 5.5e-21 5.6e-17 1 30 [] 28 57 .. 28 57 .. 0.98 Alignments for each domain: == domain 1 score: 66.7 bits; conditional E-value: 5.5e-21 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 ++PCGESCV+IPCi a++GCSCKsKVCY+N NBIL01038969.1 28 VVPCGESCVWIPCITAAIGCSCKSKVCYKN 57 69***************************9 PP >> NBIL01156090.1 Viola pubescens var. scabriuscula 5269105, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.4 12.1 3e-20 3e-16 2 30 .] 871 899 .. 870 899 .. 0.97 Alignments for each domain: == domain 1 score: 64.4 bits; conditional E-value: 3e-20 Alignment 2 IPCGESCVfIPCisallGCSCKsKVCYrN 30 +PCGESCV+IPCi a++GCSCKsKVCYrN NBIL01156090.1 871 LPCGESCVWIPCIIAAIGCSCKSKVCYRN 899 7***************************9 PP >> NBIL01143694.1 Viola pubescens var. scabriuscula 5256500, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.2 13.5 1.7e-20 1.7e-16 1 30 [] 410 439 .. 410 439 .. 0.98 Alignments for each domain: == domain 1 score: 65.2 bits; conditional E-value: 1.7e-20 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 +IPCGESCV+IPC s++ GCSCKsKVCYrN NBIL01143694.1 410 GIPCGESCVWIPCFSSAFGCSCKSKVCYRN 439 7****************************9 PP >> NBIL01104711.1 Viola pubescens var. scabriuscula 5200522, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.3 14.1 6.4e-20 6.5e-16 2 30 .] 579 607 .. 578 607 .. 0.97 Alignments for each domain: == domain 1 score: 63.3 bits; conditional E-value: 6.4e-20 Alignment 2 IPCGESCVfIPCisallGCSCKsKVCYrN 30 PCGESCVfIPCisa++GCSCKsKVCY+N NBIL01104711.1 579 FPCGESCVFIPCISAVIGCSCKSKVCYKN 607 5***************************9 PP >> NBIL01150594.1 Viola pubescens var. scabriuscula 5263593, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.8 14.1 4.6e-20 4.7e-16 2 30 .] 60 88 .. 59 88 .. 0.97 Alignments for each domain: == domain 1 score: 63.8 bits; conditional E-value: 4.6e-20 Alignment 2 IPCGESCVfIPCisallGCSCKsKVCYrN 30 PCGESCVfIPCi +++GCSCKsKVCY+N NBIL01150594.1 60 FPCGESCVFIPCITSVIGCSCKSKVCYKN 88 5***************************9 PP >> NBIL01061929.1 Viola pubescens var. scabriuscula 5129571, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.4 12.5 2.5e-19 2.5e-15 4 30 .] 1 27 [. 1 27 [. 1.00 Alignments for each domain: == domain 1 score: 61.4 bits; conditional E-value: 2.5e-19 Alignment 4 CGESCVfIPCisallGCSCKsKVCYrN 30 CGESCV+IPCi a++GCSCKsKVCYrN NBIL01061929.1 1 CGESCVWIPCITAAIGCSCKSKVCYRN 27 **************************9 PP >> NBIL01061928.1 Viola pubescens var. scabriuscula 5129570, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.9 12.5 3.8e-19 3.8e-15 4 30 .] 1 27 [. 1 27 [. 1.00 Alignments for each domain: == domain 1 score: 60.9 bits; conditional E-value: 3.8e-19 Alignment 4 CGESCVfIPCisallGCSCKsKVCYrN 30 CGESCV+IPCi a++GCSCKsKVCYrN NBIL01061928.1 1 CGESCVWIPCITAAIGCSCKSKVCYRN 27 **************************9 PP >> NBIL01116087.1 Viola pubescens var. scabriuscula 5219313, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.7 9.5 4.3e-19 4.4e-15 1 30 [] 91 120 .. 91 120 .. 0.98 Alignments for each domain: == domain 1 score: 60.7 bits; conditional E-value: 4.3e-19 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 +IPCGESCV+IP i ++GCSCKs VCYrN NBIL01116087.1 91 GIPCGESCVWIPRITGAIGCSCKSNVCYRN 120 7****************************9 PP >> NBIL01038971.1 Viola pubescens var. scabriuscula 5091427, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.4 13.5 2.2e-18 2.3e-14 4 30 .] 1 27 [. 1 27 [. 1.00 Alignments for each domain: == domain 1 score: 58.4 bits; conditional E-value: 2.2e-18 Alignment 4 CGESCVfIPCisallGCSCKsKVCYrN 30 CGESCV+IPCi a++GCSCKsKVCY+N NBIL01038971.1 1 CGESCVWIPCITAAIGCSCKSKVCYKN 27 **************************9 PP >> NBIL01038970.1 Viola pubescens var. scabriuscula 5091426, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.3 13.5 5.7e-19 5.8e-15 4 30 .] 1 27 [. 1 27 [. 1.00 Alignments for each domain: == domain 1 score: 60.3 bits; conditional E-value: 5.7e-19 Alignment 4 CGESCVfIPCisallGCSCKsKVCYrN 30 CGESCV+IPCi a++GCSCKsKVCY+N NBIL01038970.1 1 CGESCVWIPCITAAIGCSCKSKVCYKN 27 **************************9 PP >> NBIL01008359.1 Viola pubescens var. scabriuscula 5012394, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.9 16.2 1.6e-18 1.6e-14 1 30 [] 26 55 .. 26 55 .. 0.97 Alignments for each domain: == domain 1 score: 58.9 bits; conditional E-value: 1.6e-18 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 s+PCGESCV+IPCis+++GCSCKsK+CY N NBIL01008359.1 26 SVPCGESCVWIPCISSVVGCSCKSKICYMN 55 69**************************98 PP >> NBIL01054889.1 Viola pubescens var. scabriuscula 5117962, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.4 15.5 9.2e-18 9.3e-14 1 29 [. 2292 2320 .. 2292 2320 .. 0.98 Alignments for each domain: == domain 1 score: 56.4 bits; conditional E-value: 9.2e-18 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYr 29 sIPCGESCV+IPC +++GCSCKsKVCYr NBIL01054889.1 2292 SIPCGESCVWIPCFTSVIGCSCKSKVCYR 2320 7***************************9 PP >> NBIL01136227.1 Viola pubescens var. scabriuscula 5248576, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.6 12.8 8.2e-18 8.4e-14 1 29 [. 193 221 .. 193 221 .. 0.98 Alignments for each domain: == domain 1 score: 56.6 bits; conditional E-value: 8.2e-18 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYr 29 +IPCGESCV+IPC s+l+GC C+sKVCYr NBIL01136227.1 193 GIPCGESCVWIPCFSSLIGCRCRSKVCYR 221 7***************************9 PP >> NBIL01131964.1 Viola pubescens var. scabriuscula 5244047, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.6 12.8 8.2e-18 8.3e-14 1 29 [. 193 221 .. 193 221 .. 0.98 Alignments for each domain: == domain 1 score: 56.6 bits; conditional E-value: 8.2e-18 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYr 29 +IPCGESCV+IPC s+l+GC C+sKVCYr NBIL01131964.1 193 GIPCGESCVWIPCFSSLIGCRCRSKVCYR 221 7***************************9 PP >> NBIL01054676.1 Viola pubescens var. scabriuscula 5117610, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.8 12.8 6.8e-18 7e-14 1 29 [. 561 589 .. 561 589 .. 0.98 Alignments for each domain: == domain 1 score: 56.8 bits; conditional E-value: 6.8e-18 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYr 29 +IPCGESCV+IPC s+l+GC C+sKVCYr NBIL01054676.1 561 GIPCGESCVWIPCFSSLIGCRCRSKVCYR 589 7***************************9 PP >> NBIL01134054.1 Viola pubescens var. scabriuscula 5246264, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.8 12.8 6e-17 6.1e-13 1 29 [. 1789 1817 .. 1789 1817 .. 0.98 Alignments for each domain: == domain 1 score: 53.8 bits; conditional E-value: 6e-17 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYr 29 +IPCGESCV+IPCis +GC C+sKVCYr NBIL01134054.1 1789 GIPCGESCVWIPCISGHIGCRCRSKVCYR 1817 7***************************9 PP >> NBIL01121370.1 Viola pubescens var. scabriuscula 5228145, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 54.0 16.3 5.3e-17 5.4e-13 1 27 [. 176 202 .. 176 202 .. 0.98 Alignments for each domain: == domain 1 score: 54.0 bits; conditional E-value: 5.3e-17 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVC 27 ++PCGESCV+IPCi a++GCSCKsKVC NBIL01121370.1 176 VVPCGESCVWIPCITAAIGCSCKSKVC 202 69************************* PP >> NBIL01148508.1 Viola pubescens var. scabriuscula 5261499, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.6 17.0 7e-17 7.1e-13 1 27 [. 250 276 .] 250 276 .] 0.97 Alignments for each domain: == domain 1 score: 53.6 bits; conditional E-value: 7e-17 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVC 27 ++PCGESCVfIPCisa++GCSCKsKVC NBIL01148508.1 250 VLPCGESCVFIPCISAVIGCSCKSKVC 276 58************************* PP >> NBIL01094256.1 Viola pubescens var. scabriuscula 5183252, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 52.2 13.8 2e-16 2e-12 1 29 [. 572 600 .. 572 600 .. 0.98 Alignments for each domain: == domain 1 score: 52.2 bits; conditional E-value: 2e-16 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYr 29 +IPCGESCV+IPCis +GC C sKVCYr NBIL01094256.1 572 GIPCGESCVWIPCISGHIGCRCGSKVCYR 600 7***************************9 PP >> NBIL01038909.1 Viola pubescens var. scabriuscula 5091330, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.7 12.0 1.1e-15 1.2e-11 2 30 .] 530 558 .. 529 558 .. 0.96 Alignments for each domain: == domain 1 score: 49.7 bits; conditional E-value: 1.1e-15 Alignment 2 IPCGESCVfIPCisallGCSCKsKVCYrN 30 IPCGESCV++ C+sa +GCSCKs+VCY N NBIL01038909.1 530 IPCGESCVYMSCMSAFIGCSCKSRVCYIN 558 9**************************87 PP >> NBIL01142031.1 Viola pubescens var. scabriuscula 5254746, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 48.6 15.0 2.5e-15 2.5e-11 1 28 [. 632 659 .. 632 660 .. 0.97 Alignments for each domain: == domain 1 score: 48.6 bits; conditional E-value: 2.5e-15 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCY 28 +IPCGESCVfIPC +l+GCSC s VCY NBIL01142031.1 632 GIPCGESCVFIPCFTSLIGCSCSSNVCY 659 7*************************** PP >> NBIL01130348.1 Viola pubescens var. scabriuscula 5242320, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.7 12.1 1.8e-13 1.8e-09 3 30 .] 290 318 .. 288 318 .. 0.91 Alignments for each domain: == domain 1 score: 42.7 bits; conditional E-value: 1.8e-13 Alignment 3 PCGESCVfIPCis.allGCSCKsKVCYrN 30 CGESCV++PC + l GC C +KVCY+N NBIL01130348.1 290 SCGESCVWLPCGVsVLFGCKCNNKVCYKN 318 6**********885789***********9 PP >> NBIL01098616.1 Viola pubescens var. scabriuscula 5190388, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.9 12.1 1.5e-13 1.6e-09 3 30 .] 430 458 .. 428 458 .. 0.91 Alignments for each domain: == domain 1 score: 42.9 bits; conditional E-value: 1.5e-13 Alignment 3 PCGESCVfIPCis.allGCSCKsKVCYrN 30 CGESCV++PC + l GC C +KVCY+N NBIL01098616.1 430 SCGESCVWLPCGVsVLFGCKCNNKVCYKN 458 6**********885789***********9 PP >> NBIL01098617.1 Viola pubescens var. scabriuscula 5190389, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.3 12.1 1.2e-13 1.2e-09 3 30 .] 290 318 .. 288 318 .. 0.91 Alignments for each domain: == domain 1 score: 43.3 bits; conditional E-value: 1.2e-13 Alignment 3 PCGESCVfIPCis.allGCSCKsKVCYrN 30 CGESCV++PC + l GC C +KVCY+N NBIL01098617.1 290 SCGESCVWLPCGVsVLFGCKCNNKVCYKN 318 6**********885789***********9 PP >> NBIL01090773.1 Viola pubescens var. scabriuscula 5177551, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.4 17.1 1.9e-12 1.9e-08 1 27 [. 3599 3625 .. 3599 3626 .. 0.97 Alignments for each domain: == domain 1 score: 39.4 bits; conditional E-value: 1.9e-12 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVC 27 s+PCG SCVfI Cisa++GCSCKsKVC NBIL01090773.1 3599 SVPCGGSCVFITCISAVVGCSCKSKVC 3625 69************************* PP >> NBIL01110309.1 Viola pubescens var. scabriuscula 5209776, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.7 5.9 6.8e-12 6.9e-08 1 27 [. 545 572 .. 545 574 .. 0.94 Alignments for each domain: == domain 1 score: 37.7 bits; conditional E-value: 6.8e-12 Alignment 1 sIPCGESCVfIPCis.allGCSCKsKVC 27 +I CGESCV+IPC all CSC +K C NBIL01110309.1 545 GIHCGESCVYIPCSFtALLRCSCNNKQC 572 699**********9989*********99 PP >> NBIL01103596.1 Viola pubescens var. scabriuscula 5198678, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.5 4.4 3.6e-12 3.7e-08 5 30 .] 150 174 .. 150 174 .. 0.95 Alignments for each domain: == domain 1 score: 38.5 bits; conditional E-value: 3.6e-12 Alignment 5 GESCVfIPCisallGCSCKsKVCYrN 30 GE C +IPC + lGCSCK K CYrN NBIL01103596.1 150 GETCAYIPCL-TGLGCSCKDKACYRN 174 9********8.679***********9 PP >> NBIL01141280.1 Viola pubescens var. scabriuscula 5253954, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.3 14.6 8.7e-12 8.8e-08 2 29 .. 2048 2075 .. 2047 2076 .. 0.96 Alignments for each domain: == domain 1 score: 37.3 bits; conditional E-value: 8.7e-12 Alignment 2 IPCGESCVfIPCisallGCSCKsKVCYr 29 PCGESCV+I C+s+++GCSC VCY+ NBIL01141280.1 2048 FPCGESCVYIGCVSSIVGCSCSGNVCYK 2075 5**************************9 PP >> NBIL01057213.1 Viola pubescens var. scabriuscula 5121795, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.5 5.8 3.2e-11 3.3e-07 3 30 .] 79 105 .. 77 105 .. 0.92 Alignments for each domain: == domain 1 score: 35.5 bits; conditional E-value: 3.2e-11 Alignment 3 PCGESCVfIPCisallGCSCKsKVCYrN 30 CGE C +IPC + lGCSC K CYrN NBIL01057213.1 79 FCGETCAHIPCL-TGLGCSCTDKACYRN 105 6**********8.679***********9 PP >> NBIL01099996.1 Viola pubescens var. scabriuscula 5192667, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.3 5.7 3.8e-11 3.8e-07 1 30 [] 26 52 .. 26 52 .. 0.94 Alignments for each domain: == domain 1 score: 35.3 bits; conditional E-value: 3.8e-11 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 ++PCGESCV++ C s CSCK CY+N NBIL01099996.1 26 GMPCGESCVWLQCLSL---CSCKKQLCYHN 52 58***********995...*********99 PP >> NBIL01106296.1 Viola pubescens var. scabriuscula 5203118, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.6 5.7 6.3e-11 6.4e-07 1 30 [] 26 52 .. 26 52 .. 0.94 Alignments for each domain: == domain 1 score: 34.6 bits; conditional E-value: 6.3e-11 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 ++PCGESCV++ C s CSCK CY+N NBIL01106296.1 26 GMPCGESCVWLQCLSL---CSCKKQLCYHN 52 58***********995...*********99 PP >> NBIL01155155.1 Viola pubescens var. scabriuscula 5268167, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.6 7.0 6.2e-11 6.3e-07 1 30 [] 1106 1135 .. 1106 1135 .. 0.97 Alignments for each domain: == domain 1 score: 34.6 bits; conditional E-value: 6.2e-11 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVCYrN 30 +I C E C + PC a++GCSC + +CY+N NBIL01155155.1 1106 GIHCAETCLWRPCRTAVIGCSCENNICYKN 1135 689**************************9 PP >> NBIL01059040.1 Viola pubescens var. scabriuscula 5124799, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.9 10.2 2.1e-10 2.1e-06 4 29 .. 63 89 .. 62 90 .. 0.92 Alignments for each domain: == domain 1 score: 32.9 bits; conditional E-value: 2.1e-10 Alignment 4 CGESCVfIPCisallGCSCKsK.VCYr 29 CGE C+ IPCi +l+GCSC + VC++ NBIL01059040.1 63 CGETCILIPCITSLIGCSCNTRsVCWK 89 *******************97659987 PP >> NBIL01059041.1 Viola pubescens var. scabriuscula 5124800, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.9 10.2 2.1e-10 2.1e-06 4 29 .. 63 89 .. 62 90 .. 0.92 Alignments for each domain: == domain 1 score: 32.9 bits; conditional E-value: 2.1e-10 Alignment 4 CGESCVfIPCisallGCSCKsK.VCYr 29 CGE C+ IPCi +l+GCSC + VC++ NBIL01059041.1 63 CGETCILIPCITSLIGCSCNTRsVCWK 89 *******************97659987 PP >> NBIL01059039.1 Viola pubescens var. scabriuscula 5124798, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.8 10.2 2.3e-10 2.3e-06 4 29 .. 149 175 .. 148 176 .. 0.92 Alignments for each domain: == domain 1 score: 32.8 bits; conditional E-value: 2.3e-10 Alignment 4 CGESCVfIPCisallGCSCKsK.VCYr 29 CGE C+ IPCi +l+GCSC + VC++ NBIL01059039.1 149 CGETCILIPCITSLIGCSCNTRsVCWK 175 *******************97659987 PP >> NBIL01145351.1 Viola pubescens var. scabriuscula 5258251, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.5 4.0 1e-08 0.0001 4 27 .. 95 118 .. 93 120 .. 0.95 Alignments for each domain: == domain 1 score: 27.5 bits; conditional E-value: 1e-08 Alignment 4 CGESCVfIPCisallGCSCKsKVC 27 C E CVf PC s llGC C ++C NBIL01145351.1 95 CWETCVFFPCLSQLLGCVCFDRIC 118 99********************99 PP >> NBIL01138940.1 Viola pubescens var. scabriuscula 5251468, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.0 8.5 3e-08 0.0003 4 29 .. 777 802 .. 774 803 .. 0.96 Alignments for each domain: == domain 1 score: 26.0 bits; conditional E-value: 3e-08 Alignment 4 CGESCVfIPCisallGCSCKsKVCYr 29 CGE C PC a++GC C K+CY+ NBIL01138940.1 777 CGETCAINPCATAAIGCYCSKKICYK 802 *************************8 PP >> NBIL01082668.1 Viola pubescens var. scabriuscula 5164011, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.6 6.9 3.9e-08 0.0004 4 27 .. 781 804 .. 779 809 .. 0.93 Alignments for each domain: == domain 1 score: 25.6 bits; conditional E-value: 3.9e-08 Alignment 4 CGESCVfIPCisallGCSCKsKVC 27 CGE CVf PC+s l GC C+ +C NBIL01082668.1 781 CGEICVFFPCVSQLYGCECRKIIC 804 ********************9999 PP >> NBIL01072490.1 Viola pubescens var. scabriuscula 5147010, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.3 17.5 4.8e-08 0.00049 1 30 [] 247 276 .. 247 276 .. 0.91 Alignments for each domain: == domain 1 score: 25.3 bits; conditional E-value: 4.8e-08 Alignment 1 sIPCGESCV.fIPCisallGCSCKsKVCYrN 30 ++PCGESCV PC ++ GCSC +KVCY N NBIL01072490.1 247 VVPCGESCV*I-PCLTSIAGCSCSNKVCYIN 276 69******555.*****************87 PP >> NBIL01080891.1 Viola pubescens var. scabriuscula 5161033, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 24.5 4.3 8.7e-08 0.00089 4 27 .. 95 118 .. 92 120 .. 0.94 Alignments for each domain: == domain 1 score: 24.5 bits; conditional E-value: 8.7e-08 Alignment 4 CGESCVfIPCisallGCSCKsKVC 27 C E CVf PC s l GC C ++C NBIL01080891.1 95 CWETCVFFPCLSQLYGCLCLDRIC 118 99*********************9 PP >> NBIL01122265.1 Viola pubescens var. scabriuscula 5229602, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.6 9.4 3.3e-07 0.0034 7 22 .. 96 111 .. 95 113 .. 0.97 Alignments for each domain: == domain 1 score: 22.6 bits; conditional E-value: 3.3e-07 Alignment 7 SCVfIPCisallGCSC 22 SCVfIPCi ++ GCSC NBIL01122265.1 96 SCVFIPCITTIFGCSC 111 9*************** PP >> NBIL01063013.1 Viola pubescens var. scabriuscula 5131420, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.3 5.2 4.4e-07 0.0045 4 28 .. 1157 1181 .. 1154 1183 .. 0.92 Alignments for each domain: == domain 1 score: 22.3 bits; conditional E-value: 4.4e-07 Alignment 4 CGESCVfIPCisallGCSCKsKVCY 28 C E C + PC ++lGC C++ C NBIL01063013.1 1157 CSETCRWTPCATSVLGCTCRNNACS 1181 **********************995 PP >> NBIL01076836.1 Viola pubescens var. scabriuscula 5154252, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.6 5.3 7.2e-07 0.0074 7 21 .. 11 25 .. 10 26 .. 0.97 Alignments for each domain: == domain 1 score: 21.6 bits; conditional E-value: 7.2e-07 Alignment 7 SCVfIPCisallGCS 21 SCVfIPCi ++ GCS NBIL01076836.1 11 SCVFIPCITTVFGCS 25 9*************9 PP >> NBIL01054660.1 Viola pubescens var. scabriuscula 5117580, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.6 6.8 1.4e-06 0.015 3 28 .. 30 56 .. 28 58 .. 0.93 Alignments for each domain: == domain 1 score: 20.6 bits; conditional E-value: 1.4e-06 Alignment 3 PCGESCVfIPCis.allGCSCKsKVCY 28 PCGE C + C a+ GCSC CY NBIL01054660.1 30 PCGETCHYTSCFLtAVFGCSCLDGYCY 56 ***********997899*********9 PP >> NBIL01142914.1 Viola pubescens var. scabriuscula 5255681, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 19.5 9.7 3.3e-06 0.033 4 27 .. 1535 1558 .. 1532 1559 .. 0.94 Alignments for each domain: == domain 1 score: 19.5 bits; conditional E-value: 3.3e-06 Alignment 4 CGESCVfIPCisallGCSCKsKVC 27 C E C f PC s+llGC C s +C NBIL01142914.1 1535 CLETCFFFPCLSSLLGCACYSVIC 1558 99*******************999 PP >> NBIL01087216.1 Viola pubescens var. scabriuscula 5171569, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 19.4 7.4 3.6e-06 0.036 4 28 .. 447 471 .. 442 473 .. 0.92 Alignments for each domain: == domain 1 score: 19.4 bits; conditional E-value: 3.6e-06 Alignment 4 CGESCVfIPCisallGCSCKsKVCY 28 C ESC PCi ++lGC C+ +C NBIL01087216.1 447 CAESCAVKPCITSVLGCLCRRTICR 47 >> NBIL01110244.1 Viola pubescens var. scabriuscula 5209677, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.4 6.3 7.1e-06 0.072 2 27 .. 98 123 .. 97 126 .. 0.94 Alignments for each domain: == domain 1 score: 18.4 bits; conditional E-value: 7.1e-06 Alignment 2 IPCGESCVfIPCisallGCSCKsKVC 27 IPC E C I Cis GC C + C NBIL01110244.1 98 IPCFETCFLIGCISGFYGCICDGRFC 123 9********************99999 PP >> NBIL01029191.1 Viola pubescens var. scabriuscula 5075144, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.4 8.3 7.1e-06 0.072 4 27 .. 151 174 .. 149 176 .. 0.92 Alignments for each domain: == domain 1 score: 18.4 bits; conditional E-value: 7.1e-06 Alignment 4 CGESCVfIPCisallGCSCKsKVC 27 C ESC f PC+s l GC C +C NBIL01029191.1 151 CLESCFFFPCVSQLYGCECIKVIC 174 99*****************88777 PP >> NBIL01014972.1 Viola pubescens var. scabriuscula 5051637, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.0 6.3 9.7e-06 0.099 4 30 .] 32 58 .. 29 58 .. 0.89 Alignments for each domain: == domain 1 score: 18.0 bits; conditional E-value: 9.7e-06 Alignment 4 CGESCVfIPCisallGCSCKsKVCYrN 30 C E C ++ C sa+ GCSC C N NBIL01014972.1 32 CVETCYYLGCLSAMFGCSCNDGKCVNN 58 99*****************98888665 PP >> NBIL01079806.1 Viola pubescens var. scabriuscula 5159236, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.7 6.2 5.7e-06 0.058 4 28 .. 510 537 .. 507 538 .. 0.88 Alignments for each domain: == domain 1 score: 18.7 bits; conditional E-value: 5.7e-06 Alignment 4 CGESCVfIPCisallG..CSCKs.KVCY 28 CGE C + PC++++lG C CK+ CY NBIL01079806.1 510 CGETCRWGPCTASVLGvrCLCKNaDLCY 537 ****************999999834788 PP >> NBIL01099581.1 Viola pubescens var. scabriuscula 5191962, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.4 2.8 6.9e-06 0.07 5 28 .. 1 27 [. 1 28 [. 0.88 Alignments for each domain: == domain 1 score: 18.4 bits; conditional E-value: 6.9e-06 Alignment 5 GESCVfIPCisallG..CSCKs.KVCY 28 GE C + PC++++lG C CK+ CY NBIL01099581.1 1 GETCRWGPCTASVLGvrCLCKNaDLCY 27 9**************999999834788 PP >> NBIL01109779.1 Viola pubescens var. scabriuscula 5208938, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 18.2 3.2 8.2e-06 0.083 1 27 [. 1243 1269 .. 1243 1271 .. 0.93 Alignments for each domain: == domain 1 score: 18.2 bits; conditional E-value: 8.2e-06 Alignment 1 sIPCGESCVfIPCisallGCSCKsKVC 27 +IPCGE CV+ C + C +s+ C NBIL01109779.1 1243 GIPCGETCVWFRCFDPACHCDPRSRLC 1269 7**************999999999999 PP >> NBIL01102402.1 Viola pubescens var. scabriuscula 5196674, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 16.8 7.4 2.2e-05 0.23 4 30 .] 33 60 .. 32 60 .. 0.90 Alignments for each domain: == domain 1 score: 16.8 bits; conditional E-value: 2.2e-05 Alignment 4 CGESCVfIPCisallGCSCKs.KVCYrN 30 CGE C +I C l GC CK CY N NBIL01102402.1 33 CGETCKYIGCFTILQGCLCKEdNKCYTN 60 ********************62469988 PP >> NBIL01082528.1 Viola pubescens var. scabriuscula 5163767, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 16.8 5.6 2.3e-05 0.23 4 29 .. 793 818 .. 792 819 .. 0.94 Alignments for each domain: == domain 1 score: 16.8 bits; conditional E-value: 2.3e-05 Alignment 4 CGESCVfIPCisallGCSCKsKVCYr 29 C E C+f PC s ll C C +C r NBIL01082528.1 793 CYETCIFFPCLSQLLKCYCSQIICIR 818 99*******************99987 PP >> NBIL01039848.1 Viola pubescens var. scabriuscula 5092868, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 16.2 7.0 3.5e-05 0.36 4 30 .] 110 142 .. 107 142 .. 0.78 Alignments for each domain: == domain 1 score: 16.2 bits; conditional E-value: 3.5e-05 Alignment 4 CGESCVfIPCisallGCSCK......sKVCYrN 30 CGESC PC + GC CK K CY N NBIL01039848.1 110 CGESCLGRPCFTVMQGCLCKfdqetkIKFCYMN 142 *******************83333224778876 PP >> NBIL01122314.1 Viola pubescens var. scabriuscula 5229672, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 17.6 9.8 1.3e-05 0.13 4 30 .] 112 136 .. 111 136 .. 0.94 Alignments for each domain: == domain 1 score: 17.6 bits; conditional E-value: 1.3e-05 Alignment 4 CGESCVfIPCisallGCSCKsKVCYrN 30 C E C ++PC GCSCK+ CY+N NBIL01122314.1 112 CRETCYHLPCYT--WGCSCKNHGCYKN 136 99********85..8***********9 PP >> NBIL01055430.1 Viola pubescens var. scabriuscula 5118876, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 17.4 4.1 1.5e-05 0.15 4 29 .. 413 438 .. 412 439 .. 0.94 Alignments for each domain: == domain 1 score: 17.4 bits; conditional E-value: 1.5e-05 Alignment 4 CGESCVfIPCisallGCSCKsKVCYr 29 C E C f PC+s ll C C C r NBIL01055430.1 413 CWETCFFFPCMSQLLKCYCNQVLCIR 438 99*****************9999976 PP >> NBIL01077605.1 Viola pubescens var. scabriuscula 5155591, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 17.2 2.8 1.7e-05 0.17 5 28 .. 1 27 [. 1 28 [. 0.88 Alignments for each domain: == domain 1 score: 17.2 bits; conditional E-value: 1.7e-05 Alignment 5 GESCVfIPCisallG..CSCKs.KVCY 28 GE C + PC++++lG C CK+ CY NBIL01077605.1 1 GETCRWGPCTASVLGvrCLCKNaDLCY 27 9**************999999834788 PP >> NBIL01024953.1 Viola pubescens var. scabriuscula 5068143, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 16.9 6.0 2.1e-05 0.22 17 30 .] 356 369 .. 349 369 .. 0.83 2 ? -0.7 1.5 6.7 6.8e+04 19 24 .. 759 764 .. 753 766 .. 0.82 Alignments for each domain: == domain 1 score: 16.9 bits; conditional E-value: 2.1e-05 Alignment 17 llGCSCKsKVCYrN 30 +GCSCKs+VCY N NBIL01024953.1 356 FIGCSCKSRVCYIN 369 69**********87 PP == domain 2 score: -0.7 bits; conditional E-value: 6.7 Alignment 19 GCSCKs 24 GCSC s NBIL01024953.1 759 GCSCWS 764 9***76 PP >> NBIL01029192.1 Viola pubescens var. scabriuscula 5075145, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.9 7.7 4.2e-05 0.43 4 27 .. 151 174 .. 149 176 .. 0.92 Alignments for each domain: == domain 1 score: 15.9 bits; conditional E-value: 4.2e-05 Alignment 4 CGESCVfIPCisallGCSCKsKVC 27 C E C f PC+s l GC C +C NBIL01029192.1 151 CVETCFFFPCVSQLYGCECIKVIC 174 99*****************88777 PP >> NBIL01102588.1 Viola pubescens var. scabriuscula 5197008, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.3 3.6 6.6e-05 0.67 1 23 [. 154 174 .. 154 181 .. 0.87 Alignments for each domain: == domain 1 score: 15.3 bits; conditional E-value: 6.6e-05 Alignment 1 sIPCGESCVfIPCisallGCSCK 23 +IPCGE C PC s GC C NBIL01102588.1 154 VIPCGETCHNFPCRSP--GCTCN 174 7************996..99996 PP >> NBIL01137567.1 Viola pubescens var. scabriuscula 5250016, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.9 7.4 8.7e-05 0.89 4 27 .. 1651 1674 .. 1648 1676 .. 0.89 Alignments for each domain: == domain 1 score: 14.9 bits; conditional E-value: 8.7e-05 Alignment 4 CGESCVfIPCisallGCSCKsKVC 27 C E CVf+PC s +GC C C NBIL01137567.1 1651 CWETCVFLPCYSKGIGCQCAWHYC 1674 99*****************76655 PP >> NBIL01114252.1 Viola pubescens var. scabriuscula 5216283, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.7 6.9 0.0001 1 4 24 .. 86 106 .. 85 111 .. 0.88 Alignments for each domain: == domain 1 score: 14.7 bits; conditional E-value: 0.0001 Alignment 4 CGESCVfIPCisallGCSCKs 24 C E C f PCi + GC C NBIL01114252.1 86 CYETCFFFPCITQVFGCVCDR 106 99*****************75 PP >> NBIL01114253.1 Viola pubescens var. scabriuscula 5216284, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.3 6.9 0.00014 1.4 4 24 .. 353 373 .. 352 378 .. 0.88 Alignments for each domain: == domain 1 score: 14.3 bits; conditional E-value: 0.00014 Alignment 4 CGESCVfIPCisallGCSCKs 24 C E C f PCi + GC C NBIL01114253.1 353 CYETCFFFPCITQVFGCVCDR 373 99*****************75 PP >> NBIL01114251.1 Viola pubescens var. scabriuscula 5216282, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.3 6.9 0.00014 1.4 4 24 .. 86 106 .. 85 111 .. 0.88 Alignments for each domain: == domain 1 score: 14.3 bits; conditional E-value: 0.00014 Alignment 4 CGESCVfIPCisallGCSCKs 24 C E C f PCi + GC C NBIL01114251.1 86 CYETCFFFPCITQVFGCVCDR 106 99*****************75 PP >> NBIL01073220.1 Viola pubescens var. scabriuscula 5148240, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.9 6.8 8.7e-05 0.89 3 30 .] 124 149 .. 122 149 .. 0.93 Alignments for each domain: == domain 1 score: 14.9 bits; conditional E-value: 8.7e-05 Alignment 3 PCGESCVfIPCisallGCSCKsKVCYrN 30 PCGE C +PC GCSC+ C rN NBIL01073220.1 124 PCGETCELLPCYNP--GCSCRFFLCVRN 149 ***********975..*********999 PP >> NBIL01058313.1 Viola pubescens var. scabriuscula 5123611, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 13.8 6.2 0.0002 2 4 27 .. 1 24 [. 1 25 [. 0.93 Alignments for each domain: == domain 1 score: 13.8 bits; conditional E-value: 0.0002 Alignment 4 CGESCVfIPCisallGCSCKsKVC 27 C E C f PC+s ll C C C NBIL01058313.1 1 CWETCFFFPCMSQLLKCYCNQVLC 24 99*****************98777 PP >> NBIL01029811.1 Viola pubescens var. scabriuscula 5076177, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 13.7 10.1 0.00021 2.2 4 30 .] 44 68 .. 43 68 .. 0.94 Alignments for each domain: == domain 1 score: 13.7 bits; conditional E-value: 0.00021 Alignment 4 CGESCVfIPCisallGCSCKsKVCYrN 30 C E C IPC a GC C +K CYrN NBIL01029811.1 44 CKENCPIIPCQYA--GCFCVNKECYRN 68 99********876..***********9 PP >> NBIL01134343.1 Viola pubescens var. scabriuscula 5246572, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 13.0 10.5 0.00036 3.6 3 23 .. 57 77 .. 55 88 .. 0.79 Alignments for each domain: == domain 1 score: 13.0 bits; conditional E-value: 0.00036 Alignment 3 PCGESCVfIPCisallGCSCK 23 CGE C +PC s+ GC C NBIL01134343.1 57 FCGETCSVVPCFSSSRGCGCT 77 6*******************6 PP >> NBIL01044746.1 Viola pubescens var. scabriuscula 5101041, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.8 8.0 0.00041 4.2 2 30 .] 107 135 .. 106 135 .. 0.96 Alignments for each domain: == domain 1 score: 12.8 bits; conditional E-value: 0.00041 Alignment 2 IPCGESCVfIPCisallGCSCKsKVCYrN 30 I CGE C C s + GC CK+ C +N NBIL01044746.1 107 IYCGETCRGGFCFSMIYGCQCKNDFCIKN 135 77************************999 PP >> NBIL01037573.1 Viola pubescens var. scabriuscula 5089096, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.6 7.6 0.00047 4.8 1 30 [] 25 53 .. 25 53 .. 0.80 Alignments for each domain: == domain 1 score: 12.6 bits; conditional E-value: 0.00047 Alignment 1 sIPCGESCVfIPCisallGCSCKsK.VCYrN 30 +IPCGE C PC s GC C C rN NBIL01037573.1 25 VIPCGETCHNFPCRSP--GCTCNREfFCVRN 53 7************996..9999654246665 PP >> NBIL01124406.1 Viola pubescens var. scabriuscula 5233101, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.9 1.7 0.00075 7.6 15 27 .. 18 30 .. 14 33 .. 0.85 Alignments for each domain: == domain 1 score: 11.9 bits; conditional E-value: 0.00075 Alignment 15 sallGCSCKsKVC 27 s++lGCSCK C NBIL01124406.1 18 SSILGCSCKLSTC 30 89*******8888 PP >> NBIL01128555.1 Viola pubescens var. scabriuscula 5240016, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.8 1.5 0.00083 8.4 18 28 .. 80 90 .. 77 91 .. 0.86 Alignments for each domain: == domain 1 score: 11.8 bits; conditional E-value: 0.00083 Alignment 18 lGCSCKsKVCY 28 l CSC KVCY NBIL01128555.1 80 LLCSCSQKVCY 90 55********* PP >> NBIL01051753.1 Viola pubescens var. scabriuscula 5112760, whole genome shotgun sequence_R2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.1 0.3 0.00068 6.9 18 28 .. 28 38 .. 25 39 .. 0.93 Alignments for each domain: == domain 1 score: 12.1 bits; conditional E-value: 0.00068 Alignment 18 lGCSCKsKVCY 28 +G SCKs VCY NBIL01051753.1 28 IGPSCKSHVCY 38 899******** PP >> NBIL01131936.1 Viola pubescens var. scabriuscula 5244018, whole genome shotgun sequence_R0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 9.2 0.6 0.0054 55 19 29 .. 31 41 .. 23 42 .. 0.86 2 ? 2.8 0.0 0.53 5.4e+03 6 13 .. 236 243 .. 235 248 .. 0.92 Alignments for each domain: == domain 1 score: 9.2 bits; conditional E-value: 0.0054 Alignment 19 GCSCKsKVCYr 29 G SC s VCY+ NBIL01131936.1 31 GASCDSSVCYK 41 99********9 PP == domain 2 score: 2.8 bits; conditional E-value: 0.53 Alignment 6 ESCVfIPC 13 ESC++I C NBIL01131936.1 236 ESCIHIGC 243 9*****99 PP >> NBIL01032974.1 Viola pubescens var. scabriuscula 5081437, whole genome shotgun sequence_0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.3 5.1 0.00014 1.4 4 27 .. 772 795 .. 771 796 .] 0.93 Alignments for each domain: == domain 1 score: 14.3 bits; conditional E-value: 0.00014 Alignment 4 CGESCVfIPCisallGCSCKsKVC 27 C E C f PC+s ll C C C NBIL01032974.1 772 CWETCFFFPCMSQLLKCYCNQVLC 795 99*****************98777 PP >> NBIL01119126.1 Viola pubescens var. scabriuscula 5224394, whole genome shotgun sequence_R1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.3 5.1 0.00014 1.4 4 27 .. 793 816 .. 792 817 .] 0.93 Alignments for each domain: == domain 1 score: 14.3 bits; conditional E-value: 0.00014 Alignment 4 CGESCVfIPCisallGCSCKsKVC 27 C E C f PC+s ll C C C NBIL01119126.1 793 CWETCFFFPCMSQLLKCYCNQVLC 816 99*****************98777 PP >> NBIL01135223.1 Viola pubescens var. scabriuscula 5247511, whole genome shotgun sequence_2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.6 0.3 0.00098 10 18 28 .. 28 38 .. 25 39 .. 0.93 Alignments for each domain: == domain 1 score: 11.6 bits; conditional E-value: 0.00098 Alignment 18 lGCSCKsKVCY 28 +G SCKs VCY NBIL01135223.1 28 IGPSCKSHVCY 38 899******** PP >> NBIL01085128.1 Viola pubescens var. scabriuscula 5168114, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 10.4 4.0 0.0023 24 4 17 .. 6 19 .. 5 29 .. 0.88 Alignments for each domain: == domain 1 score: 10.4 bits; conditional E-value: 0.0023 Alignment 4 CGESCVfIPCisal 17 C E C++IPC sa NBIL01085128.1 6 CLETCIYIPCYSAF 19 88*********986 PP >> NBIL01077077.1 Viola pubescens var. scabriuscula 5154634, whole genome shotgun sequence_1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 10.9 8.7 0.0015 15 1 22 [. 769 790 .. 769 793 .. 0.94 Alignments for each domain: == domain 1 score: 10.9 bits; conditional E-value: 0.0015 Alignment 1 sIPCGESCVfIPCisallGCSC 22 +I CGE C PC s+ GC C NBIL01077077.1 769 GIFCGETCSVFPCFSSSRGCGC 790 688******************* PP
About Us
We are the iGEM Team Tuebingen, a group of motivated students who are working on creating a fast expression platform for grafted cyclotides. We are aiming to provide a system that gives everyone the ability to stabilize antimicrobial peptides to create better medical agents.
